Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A017SRL5

Protein Details
Accession A0A017SRL5    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
9-33VVSVDPQSKRERKKKSGNAKVAFHSHydrophilic
NLS Segment(s)
PositionSequence
17-24KRERKKKS
Subcellular Location(s) nucl 7, mito 7, mito_nucl 7, plas 6
Family & Domain DBs
Amino Acid Sequences MITVSMNPVVSVDPQSKRERKKKSGNAKVAFHSDRCAFVRFCLYFNFHSPLLIFFLDFWFWIWILPGLYNFSLILHSLYISQSLLRISAQLTNLLAPAFLLFRPPWEDSFRCRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.37
3 0.45
4 0.54
5 0.62
6 0.68
7 0.72
8 0.79
9 0.84
10 0.86
11 0.89
12 0.89
13 0.87
14 0.81
15 0.74
16 0.71
17 0.63
18 0.52
19 0.45
20 0.36
21 0.33
22 0.3
23 0.3
24 0.22
25 0.21
26 0.27
27 0.24
28 0.24
29 0.22
30 0.24
31 0.22
32 0.25
33 0.27
34 0.2
35 0.19
36 0.18
37 0.17
38 0.15
39 0.13
40 0.1
41 0.07
42 0.08
43 0.07
44 0.07
45 0.07
46 0.05
47 0.05
48 0.05
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.08
55 0.08
56 0.08
57 0.08
58 0.07
59 0.07
60 0.07
61 0.07
62 0.06
63 0.06
64 0.06
65 0.06
66 0.07
67 0.07
68 0.06
69 0.07
70 0.07
71 0.07
72 0.07
73 0.07
74 0.08
75 0.11
76 0.12
77 0.12
78 0.13
79 0.12
80 0.13
81 0.12
82 0.11
83 0.07
84 0.08
85 0.07
86 0.07
87 0.1
88 0.09
89 0.12
90 0.17
91 0.2
92 0.22
93 0.28
94 0.32