Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A017SB52

Protein Details
Accession A0A017SB52   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MRAKWRKKRVRRLKRKRRKMRISVSPAPSDBasic
NLS Segment(s)
PositionSequence
3-21AKWRKKRVRRLKRKRRKMR
Subcellular Location(s) plas 11, mito 9, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007836  Ribosomal_L41  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF05162  Ribosomal_L41  
Amino Acid Sequences MRAKWRKKRVRRLKRKRRKMRISVSPAPSDSLSGLSLLTSRKPESAVQLVSLYLQPLGSINGFDFFAGQCLFGVAIVCLVGLEGSFATDPGSVCMGTGQFLLDSSYFTYRPTVAAGVLELWRGHFDLKELPKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.97
2 0.97
3 0.97
4 0.97
5 0.97
6 0.96
7 0.95
8 0.94
9 0.92
10 0.9
11 0.84
12 0.77
13 0.66
14 0.58
15 0.47
16 0.37
17 0.28
18 0.2
19 0.15
20 0.11
21 0.1
22 0.07
23 0.09
24 0.09
25 0.1
26 0.12
27 0.12
28 0.13
29 0.15
30 0.16
31 0.19
32 0.23
33 0.22
34 0.2
35 0.19
36 0.19
37 0.17
38 0.17
39 0.12
40 0.07
41 0.06
42 0.05
43 0.05
44 0.06
45 0.05
46 0.05
47 0.05
48 0.06
49 0.06
50 0.06
51 0.06
52 0.05
53 0.06
54 0.06
55 0.05
56 0.04
57 0.05
58 0.05
59 0.04
60 0.05
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.02
68 0.02
69 0.02
70 0.02
71 0.03
72 0.03
73 0.03
74 0.04
75 0.05
76 0.05
77 0.06
78 0.08
79 0.07
80 0.07
81 0.08
82 0.07
83 0.07
84 0.07
85 0.06
86 0.05
87 0.06
88 0.07
89 0.06
90 0.07
91 0.09
92 0.12
93 0.12
94 0.12
95 0.14
96 0.13
97 0.14
98 0.15
99 0.14
100 0.11
101 0.12
102 0.11
103 0.12
104 0.12
105 0.13
106 0.11
107 0.11
108 0.12
109 0.12
110 0.13
111 0.11
112 0.13
113 0.2