Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A017SNI7

Protein Details
Accession A0A017SNI7   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
15-36ISKYNQRPTKCNRKRRLTTEYGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 10
Family & Domain DBs
Amino Acid Sequences MGALTEIQGLIVKQISKYNQRPTKCNRKRRLTTEYGAQSTKWPNGRSLQPQRLIRHYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.2
3 0.28
4 0.35
5 0.45
6 0.5
7 0.52
8 0.58
9 0.62
10 0.69
11 0.7
12 0.74
13 0.73
14 0.76
15 0.81
16 0.81
17 0.81
18 0.75
19 0.68
20 0.66
21 0.61
22 0.53
23 0.46
24 0.39
25 0.35
26 0.32
27 0.35
28 0.32
29 0.28
30 0.28
31 0.33
32 0.4
33 0.47
34 0.54
35 0.57
36 0.6
37 0.67
38 0.69