Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A017SQ51

Protein Details
Accession A0A017SQ51   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
100-122LNWLPERNRWWRCKTKRIGCDRDHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 24, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036058  Kazal_dom_sf  
Amino Acid Sequences MQLILATLLLLLSQALPVLVPVVAEEGVAPAHACSETCPKAHPPVCAKNAAEAFEIFDNSCMFDKANCEGLDIVQYQTTDADGAPIEANGIFHDIWALVLNWLPERNRWWRCKTKRIGCDRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.04
5 0.04
6 0.04
7 0.04
8 0.04
9 0.06
10 0.06
11 0.06
12 0.06
13 0.05
14 0.05
15 0.05
16 0.05
17 0.04
18 0.05
19 0.05
20 0.05
21 0.07
22 0.14
23 0.17
24 0.17
25 0.2
26 0.22
27 0.31
28 0.34
29 0.37
30 0.37
31 0.43
32 0.46
33 0.48
34 0.45
35 0.42
36 0.4
37 0.36
38 0.29
39 0.21
40 0.19
41 0.15
42 0.15
43 0.1
44 0.09
45 0.07
46 0.07
47 0.08
48 0.07
49 0.06
50 0.06
51 0.08
52 0.09
53 0.14
54 0.13
55 0.13
56 0.13
57 0.13
58 0.15
59 0.14
60 0.12
61 0.09
62 0.09
63 0.08
64 0.08
65 0.08
66 0.06
67 0.05
68 0.06
69 0.05
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.05
77 0.08
78 0.06
79 0.06
80 0.07
81 0.06
82 0.06
83 0.07
84 0.07
85 0.06
86 0.07
87 0.08
88 0.09
89 0.13
90 0.13
91 0.15
92 0.2
93 0.3
94 0.38
95 0.45
96 0.53
97 0.61
98 0.7
99 0.78
100 0.83
101 0.84
102 0.85