Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A017SD97

Protein Details
Accession A0A017SD97    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
78-120RITYNPSRRVQKRRHGFLARLRSRGGRKILMRRRQRGKKALSWHydrophilic
NLS Segment(s)
PositionSequence
84-117SRRVQKRRHGFLARLRSRGGRKILMRRRQRGKKA
Subcellular Location(s) nucl 13.5, mito 10, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MFSRRTLPALRTLRAQTPLTTTSLRPFSSLLTSRSSPPTTAITSTSTLLSPLTSTLTSAFNQSPSRQFSASASLAGKRITYNPSRRVQKRRHGFLARLRSRGGRKILMRRRQRGKKALSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.45
3 0.36
4 0.35
5 0.35
6 0.33
7 0.31
8 0.27
9 0.27
10 0.3
11 0.29
12 0.25
13 0.24
14 0.22
15 0.27
16 0.29
17 0.25
18 0.25
19 0.27
20 0.28
21 0.33
22 0.32
23 0.26
24 0.25
25 0.26
26 0.22
27 0.22
28 0.21
29 0.19
30 0.19
31 0.19
32 0.17
33 0.14
34 0.12
35 0.11
36 0.09
37 0.07
38 0.06
39 0.07
40 0.06
41 0.06
42 0.07
43 0.09
44 0.09
45 0.11
46 0.11
47 0.12
48 0.14
49 0.15
50 0.18
51 0.19
52 0.21
53 0.19
54 0.19
55 0.18
56 0.22
57 0.21
58 0.19
59 0.17
60 0.16
61 0.16
62 0.16
63 0.15
64 0.11
65 0.13
66 0.16
67 0.23
68 0.3
69 0.36
70 0.45
71 0.54
72 0.62
73 0.69
74 0.73
75 0.76
76 0.79
77 0.8
78 0.81
79 0.77
80 0.76
81 0.75
82 0.77
83 0.73
84 0.65
85 0.59
86 0.56
87 0.55
88 0.56
89 0.52
90 0.49
91 0.51
92 0.6
93 0.68
94 0.71
95 0.76
96 0.79
97 0.84
98 0.87
99 0.89
100 0.88