Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A017S0M3

Protein Details
Accession A0A017S0M3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
47-70PQEHLRQRSKKPTHPSKQCFNQYMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
Amino Acid Sequences MKFLNRSLAVFLLLRANLDIWKASPSESAFVLGIGTDPSLSKYSIHPQEHLRQRSKKPTHPSKQCFNQYMPPVWCPAIKQPHHI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.13
4 0.11
5 0.12
6 0.12
7 0.08
8 0.1
9 0.1
10 0.1
11 0.12
12 0.13
13 0.13
14 0.13
15 0.13
16 0.12
17 0.11
18 0.1
19 0.07
20 0.07
21 0.05
22 0.05
23 0.04
24 0.04
25 0.05
26 0.07
27 0.07
28 0.08
29 0.09
30 0.17
31 0.25
32 0.26
33 0.26
34 0.3
35 0.38
36 0.47
37 0.52
38 0.53
39 0.53
40 0.59
41 0.67
42 0.7
43 0.7
44 0.72
45 0.76
46 0.78
47 0.82
48 0.82
49 0.81
50 0.83
51 0.83
52 0.77
53 0.7
54 0.68
55 0.62
56 0.63
57 0.56
58 0.48
59 0.42
60 0.39
61 0.37
62 0.31
63 0.35
64 0.38