Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A017S9S0

Protein Details
Accession A0A017S9S0   
Localization Confidence Low
Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-27ISVDQKRPLRAQKRRDPSLSNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12.5, mito_nucl 12.333, nucl 11, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR041188  HTH_ABP1_N  
Pfam View protein in Pfam  
PF18107  HTH_ABP1_N  
Amino Acid Sequences MPPRRVISVDQKRPLRAQKRRDPSLSNITLCEWFKSTYQQPIALSSVSEILSSRYAFLDDTSVSQRAPTQRSDPKRLQREHWPELKDNLFQWMQGAEQHIMICAITLREKAEFFWRNLEKYQNNIQRQEIQNRRQVDIRGYFGGQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.72
3 0.71
4 0.72
5 0.73
6 0.79
7 0.82
8 0.81
9 0.76
10 0.72
11 0.73
12 0.68
13 0.58
14 0.49
15 0.43
16 0.42
17 0.38
18 0.32
19 0.24
20 0.2
21 0.19
22 0.24
23 0.26
24 0.29
25 0.3
26 0.31
27 0.3
28 0.31
29 0.31
30 0.25
31 0.22
32 0.14
33 0.14
34 0.11
35 0.11
36 0.08
37 0.08
38 0.1
39 0.1
40 0.1
41 0.08
42 0.09
43 0.09
44 0.09
45 0.09
46 0.07
47 0.09
48 0.11
49 0.11
50 0.11
51 0.11
52 0.13
53 0.16
54 0.18
55 0.18
56 0.22
57 0.3
58 0.36
59 0.43
60 0.47
61 0.52
62 0.59
63 0.59
64 0.57
65 0.59
66 0.62
67 0.61
68 0.6
69 0.55
70 0.48
71 0.49
72 0.48
73 0.39
74 0.3
75 0.28
76 0.22
77 0.18
78 0.17
79 0.13
80 0.11
81 0.11
82 0.13
83 0.09
84 0.1
85 0.1
86 0.09
87 0.09
88 0.09
89 0.07
90 0.05
91 0.06
92 0.06
93 0.07
94 0.08
95 0.1
96 0.11
97 0.12
98 0.21
99 0.24
100 0.24
101 0.33
102 0.35
103 0.36
104 0.39
105 0.46
106 0.39
107 0.41
108 0.5
109 0.5
110 0.52
111 0.53
112 0.54
113 0.55
114 0.58
115 0.63
116 0.63
117 0.6
118 0.61
119 0.61
120 0.6
121 0.56
122 0.53
123 0.51
124 0.47
125 0.45
126 0.41