Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D8JT26

Protein Details
Accession A0A0D8JT26    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
49-72CQRPTSGKRRRSARRRCDERPIASHydrophilic
NLS Segment(s)
PositionSequence
55-64GKRRRSARRR
Subcellular Location(s) nucl 17, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018247  EF_Hand_1_Ca_BS  
KEGG cim:CIMG_12391  -  
PROSITE View protein in PROSITE  
PS00018  EF_HAND_1  
Amino Acid Sequences MDSDKGRRLTRSDIGAALYVDRPAPENGNSGGNGSWPFNGIDAVMKRLCQRPTSGKRRRSARRRCDERPIASKVPRDQHQDSALAWEGLSAAHNKGEILVVGSLSYMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.34
3 0.3
4 0.24
5 0.19
6 0.14
7 0.12
8 0.11
9 0.12
10 0.12
11 0.14
12 0.13
13 0.16
14 0.16
15 0.18
16 0.18
17 0.17
18 0.15
19 0.14
20 0.14
21 0.12
22 0.11
23 0.1
24 0.1
25 0.09
26 0.09
27 0.07
28 0.1
29 0.1
30 0.13
31 0.13
32 0.13
33 0.15
34 0.21
35 0.22
36 0.19
37 0.23
38 0.3
39 0.39
40 0.5
41 0.56
42 0.58
43 0.64
44 0.72
45 0.78
46 0.79
47 0.8
48 0.8
49 0.82
50 0.84
51 0.82
52 0.83
53 0.81
54 0.77
55 0.72
56 0.68
57 0.63
58 0.59
59 0.59
60 0.55
61 0.54
62 0.52
63 0.54
64 0.5
65 0.49
66 0.47
67 0.44
68 0.38
69 0.35
70 0.31
71 0.23
72 0.2
73 0.14
74 0.12
75 0.1
76 0.11
77 0.08
78 0.08
79 0.09
80 0.09
81 0.09
82 0.09
83 0.1
84 0.09
85 0.1
86 0.09
87 0.09
88 0.08