FuNGI

Q5BDB5

Protein Details

Accession

Q5BDB5

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
24-48	RTAGSFPPSRRARRKSVDRYRGVSP	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

plas 21, extr 2, vacu 2

Family & Domain DBs

InterPro	View protein in InterPro IPR026841 Aur1/Ipt1
Gene Ontology	GO:0070916 C:inositol phosphoceramide synthase complex GO:0016020 C:membrane GO:0045140 F:inositol phosphoceramide synthase activity GO:0006673 P:inositol phosphoceramide metabolic process GO:0030148 P:sphingolipid biosynthetic process
KEGG	ani:AN1465.2 -
Pfam	View protein in Pfam PF14378 PAP2_3
CDD	cd03386 PAP2_Aur1_like

Amino Acid Sequences

MGAGAILEPLVVIVLLFGGTWINRTAGSFPPSRRARRKSVDRYRGVSPDSIESGLCSPTSKDGLLKDRPLSPASSHCGHESWRKRRIGILLWTTEVTSPNTVVFQDRLLSRLLRKLPFLAECWYWALVYWTYQLGRAFTAVTLQEGTVDVARKHALKLIEIEQALGLFWEVPIQQFFLRHPLLMKWTNWIYSFIHIPGTIAFLVWLYYYTITRNHSDEPQSGKPRGTASGSPAGPLLYQARRRTLAVCNLLAFVVFTLWPCMPPRLLSDEKVQGPEGKLARSFGFVDTVHGAEGAGSVWTENRFCNQYAAMPSLHFGYSLMIGLTIMTIPLPAHHRVSTRVRIGPFGAQIPSRQRLVCLFLGFAYPFMILAAIVATANHFILDAVAGAIVCTLGWKFNSVLLNLLPVEDYFLWLVRIHKPEPAEMAGPLDLEEWTDEIEAETA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.03
2	0.03
3	0.03
4	0.03
5	0.05
6	0.05
7	0.07
8	0.08
9	0.09
10	0.09
11	0.11
12	0.14
13	0.19
14	0.23
15	0.28
16	0.3
17	0.39
18	0.47
19	0.56
20	0.64
21	0.65
22	0.71
23	0.76
24	0.84
25	0.85
26	0.88
27	0.89
28	0.86
29	0.83
30	0.79
31	0.73
32	0.65
33	0.57
34	0.48
35	0.41
36	0.36
37	0.33
38	0.26
39	0.22
40	0.21
41	0.19
42	0.16
43	0.13
44	0.12
45	0.15
46	0.17
47	0.17
48	0.18
49	0.23
50	0.31
51	0.36
52	0.41
53	0.4
54	0.42
55	0.44
56	0.43
57	0.4
58	0.34
59	0.34
60	0.34
61	0.34
62	0.31
63	0.3
64	0.3
65	0.31
66	0.38
67	0.43
68	0.46
69	0.52
70	0.54
71	0.53
72	0.56
73	0.59
74	0.56
75	0.55
76	0.53
77	0.46
78	0.45
79	0.44
80	0.39
81	0.35
82	0.29
83	0.22
84	0.16
85	0.14
86	0.13
87	0.13
88	0.13
89	0.14
90	0.13
91	0.12
92	0.14
93	0.14
94	0.14
95	0.16
96	0.17
97	0.17
98	0.24
99	0.29
100	0.28
101	0.29
102	0.3
103	0.32
104	0.32
105	0.32
106	0.28
107	0.23
108	0.22
109	0.23
110	0.21
111	0.17
112	0.15
113	0.15
114	0.12
115	0.12
116	0.12
117	0.12
118	0.12
119	0.14
120	0.15
121	0.13
122	0.13
123	0.12
124	0.12
125	0.1
126	0.12
127	0.09
128	0.09
129	0.09
130	0.08
131	0.08
132	0.08
133	0.09
134	0.09
135	0.1
136	0.09
137	0.11
138	0.12
139	0.13
140	0.13
141	0.16
142	0.14
143	0.14
144	0.17
145	0.19
146	0.22
147	0.21
148	0.2
149	0.17
150	0.16
151	0.14
152	0.11
153	0.08
154	0.03
155	0.03
156	0.04
157	0.04
158	0.05
159	0.06
160	0.07
161	0.08
162	0.08
163	0.09
164	0.14
165	0.14
166	0.14
167	0.15
168	0.15
169	0.2
170	0.23
171	0.23
172	0.21
173	0.22
174	0.23
175	0.23
176	0.24
177	0.19
178	0.17
179	0.18
180	0.14
181	0.14
182	0.12
183	0.12
184	0.09
185	0.1
186	0.08
187	0.07
188	0.06
189	0.05
190	0.05
191	0.05
192	0.05
193	0.04
194	0.05
195	0.05
196	0.06
197	0.09
198	0.11
199	0.13
200	0.15
201	0.16
202	0.19
203	0.21
204	0.23
205	0.27
206	0.32
207	0.34
208	0.34
209	0.32
210	0.31
211	0.29
212	0.28
213	0.24
214	0.18
215	0.18
216	0.23
217	0.23
218	0.21
219	0.2
220	0.19
221	0.16
222	0.16
223	0.15
224	0.14
225	0.2
226	0.21
227	0.24
228	0.25
229	0.26
230	0.28
231	0.29
232	0.31
233	0.29
234	0.28
235	0.25
236	0.24
237	0.23
238	0.2
239	0.16
240	0.08
241	0.05
242	0.04
243	0.04
244	0.06
245	0.06
246	0.07
247	0.08
248	0.1
249	0.1
250	0.11
251	0.13
252	0.18
253	0.2
254	0.21
255	0.25
256	0.3
257	0.3
258	0.31
259	0.29
260	0.25
261	0.24
262	0.27
263	0.24
264	0.19
265	0.18
266	0.19
267	0.18
268	0.18
269	0.18
270	0.13
271	0.15
272	0.14
273	0.15
274	0.15
275	0.14
276	0.12
277	0.11
278	0.1
279	0.07
280	0.07
281	0.05
282	0.04
283	0.03
284	0.03
285	0.05
286	0.06
287	0.07
288	0.07
289	0.1
290	0.13
291	0.14
292	0.15
293	0.15
294	0.18
295	0.19
296	0.21
297	0.19
298	0.17
299	0.16
300	0.16
301	0.16
302	0.12
303	0.09
304	0.08
305	0.08
306	0.08
307	0.07
308	0.06
309	0.05
310	0.05
311	0.05
312	0.04
313	0.04
314	0.03
315	0.04
316	0.03
317	0.06
318	0.1
319	0.12
320	0.15
321	0.18
322	0.2
323	0.26
324	0.33
325	0.39
326	0.41
327	0.44
328	0.42
329	0.42
330	0.42
331	0.39
332	0.34
333	0.29
334	0.25
335	0.21
336	0.24
337	0.29
338	0.3
339	0.29
340	0.27
341	0.26
342	0.26
343	0.31
344	0.3
345	0.25
346	0.22
347	0.19
348	0.22
349	0.2
350	0.18
351	0.13
352	0.1
353	0.09
354	0.08
355	0.08
356	0.05
357	0.05
358	0.05
359	0.04
360	0.04
361	0.04
362	0.04
363	0.05
364	0.06
365	0.05
366	0.05
367	0.05
368	0.05
369	0.06
370	0.05
371	0.04
372	0.05
373	0.05
374	0.04
375	0.04
376	0.04
377	0.03
378	0.04
379	0.05
380	0.07
381	0.07
382	0.1
383	0.11
384	0.16
385	0.19
386	0.18
387	0.21
388	0.19
389	0.21
390	0.19
391	0.19
392	0.15
393	0.12
394	0.16
395	0.13
396	0.14
397	0.12
398	0.12
399	0.13
400	0.15
401	0.18
402	0.21
403	0.27
404	0.26
405	0.29
406	0.31
407	0.33
408	0.36
409	0.36
410	0.31
411	0.26
412	0.27
413	0.24
414	0.22
415	0.19
416	0.15
417	0.11
418	0.1
419	0.11
420	0.08
421	0.09
422	0.09
423	0.08

Q5BDB5

3D AlphaFold-predicted Structure Viewer