Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5BDB5

Protein Details
Accession Q5BDB5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
24-48RTAGSFPPSRRARRKSVDRYRGVSPHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 21, extr 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR026841  Aur1/Ipt1  
Gene Ontology GO:0070916  C:inositol phosphoceramide synthase complex  
GO:0016020  C:membrane  
GO:0045140  F:inositol phosphoceramide synthase activity  
GO:0006673  P:inositol phosphoceramide metabolic process  
GO:0030148  P:sphingolipid biosynthetic process  
KEGG ani:AN1465.2  -  
Pfam View protein in Pfam  
PF14378  PAP2_3  
CDD cd03386  PAP2_Aur1_like  
Amino Acid Sequences MGAGAILEPLVVIVLLFGGTWINRTAGSFPPSRRARRKSVDRYRGVSPDSIESGLCSPTSKDGLLKDRPLSPASSHCGHESWRKRRIGILLWTTEVTSPNTVVFQDRLLSRLLRKLPFLAECWYWALVYWTYQLGRAFTAVTLQEGTVDVARKHALKLIEIEQALGLFWEVPIQQFFLRHPLLMKWTNWIYSFIHIPGTIAFLVWLYYYTITRNHSDEPQSGKPRGTASGSPAGPLLYQARRRTLAVCNLLAFVVFTLWPCMPPRLLSDEKVQGPEGKLARSFGFVDTVHGAEGAGSVWTENRFCNQYAAMPSLHFGYSLMIGLTIMTIPLPAHHRVSTRVRIGPFGAQIPSRQRLVCLFLGFAYPFMILAAIVATANHFILDAVAGAIVCTLGWKFNSVLLNLLPVEDYFLWLVRIHKPEPAEMAGPLDLEEWTDEIEAETA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.05
6 0.05
7 0.07
8 0.08
9 0.09
10 0.09
11 0.11
12 0.14
13 0.19
14 0.23
15 0.28
16 0.3
17 0.39
18 0.47
19 0.56
20 0.64
21 0.65
22 0.71
23 0.76
24 0.84
25 0.85
26 0.88
27 0.89
28 0.86
29 0.83
30 0.79
31 0.73
32 0.65
33 0.57
34 0.48
35 0.41
36 0.36
37 0.33
38 0.26
39 0.22
40 0.21
41 0.19
42 0.16
43 0.13
44 0.12
45 0.15
46 0.17
47 0.17
48 0.18
49 0.23
50 0.31
51 0.36
52 0.41
53 0.4
54 0.42
55 0.44
56 0.43
57 0.4
58 0.34
59 0.34
60 0.34
61 0.34
62 0.31
63 0.3
64 0.3
65 0.31
66 0.38
67 0.43
68 0.46
69 0.52
70 0.54
71 0.53
72 0.56
73 0.59
74 0.56
75 0.55
76 0.53
77 0.46
78 0.45
79 0.44
80 0.39
81 0.35
82 0.29
83 0.22
84 0.16
85 0.14
86 0.13
87 0.13
88 0.13
89 0.14
90 0.13
91 0.12
92 0.14
93 0.14
94 0.14
95 0.16
96 0.17
97 0.17
98 0.24
99 0.29
100 0.28
101 0.29
102 0.3
103 0.32
104 0.32
105 0.32
106 0.28
107 0.23
108 0.22
109 0.23
110 0.21
111 0.17
112 0.15
113 0.15
114 0.12
115 0.12
116 0.12
117 0.12
118 0.12
119 0.14
120 0.15
121 0.13
122 0.13
123 0.12
124 0.12
125 0.1
126 0.12
127 0.09
128 0.09
129 0.09
130 0.08
131 0.08
132 0.08
133 0.09
134 0.09
135 0.1
136 0.09
137 0.11
138 0.12
139 0.13
140 0.13
141 0.16
142 0.14
143 0.14
144 0.17
145 0.19
146 0.22
147 0.21
148 0.2
149 0.17
150 0.16
151 0.14
152 0.11
153 0.08
154 0.03
155 0.03
156 0.04
157 0.04
158 0.05
159 0.06
160 0.07
161 0.08
162 0.08
163 0.09
164 0.14
165 0.14
166 0.14
167 0.15
168 0.15
169 0.2
170 0.23
171 0.23
172 0.21
173 0.22
174 0.23
175 0.23
176 0.24
177 0.19
178 0.17
179 0.18
180 0.14
181 0.14
182 0.12
183 0.12
184 0.09
185 0.1
186 0.08
187 0.07
188 0.06
189 0.05
190 0.05
191 0.05
192 0.05
193 0.04
194 0.05
195 0.05
196 0.06
197 0.09
198 0.11
199 0.13
200 0.15
201 0.16
202 0.19
203 0.21
204 0.23
205 0.27
206 0.32
207 0.34
208 0.34
209 0.32
210 0.31
211 0.29
212 0.28
213 0.24
214 0.18
215 0.18
216 0.23
217 0.23
218 0.21
219 0.2
220 0.19
221 0.16
222 0.16
223 0.15
224 0.14
225 0.2
226 0.21
227 0.24
228 0.25
229 0.26
230 0.28
231 0.29
232 0.31
233 0.29
234 0.28
235 0.25
236 0.24
237 0.23
238 0.2
239 0.16
240 0.08
241 0.05
242 0.04
243 0.04
244 0.06
245 0.06
246 0.07
247 0.08
248 0.1
249 0.1
250 0.11
251 0.13
252 0.18
253 0.2
254 0.21
255 0.25
256 0.3
257 0.3
258 0.31
259 0.29
260 0.25
261 0.24
262 0.27
263 0.24
264 0.19
265 0.18
266 0.19
267 0.18
268 0.18
269 0.18
270 0.13
271 0.15
272 0.14
273 0.15
274 0.15
275 0.14
276 0.12
277 0.11
278 0.1
279 0.07
280 0.07
281 0.05
282 0.04
283 0.03
284 0.03
285 0.05
286 0.06
287 0.07
288 0.07
289 0.1
290 0.13
291 0.14
292 0.15
293 0.15
294 0.18
295 0.19
296 0.21
297 0.19
298 0.17
299 0.16
300 0.16
301 0.16
302 0.12
303 0.09
304 0.08
305 0.08
306 0.08
307 0.07
308 0.06
309 0.05
310 0.05
311 0.05
312 0.04
313 0.04
314 0.03
315 0.04
316 0.03
317 0.06
318 0.1
319 0.12
320 0.15
321 0.18
322 0.2
323 0.26
324 0.33
325 0.39
326 0.41
327 0.44
328 0.42
329 0.42
330 0.42
331 0.39
332 0.34
333 0.29
334 0.25
335 0.21
336 0.24
337 0.29
338 0.3
339 0.29
340 0.27
341 0.26
342 0.26
343 0.31
344 0.3
345 0.25
346 0.22
347 0.19
348 0.22
349 0.2
350 0.18
351 0.13
352 0.1
353 0.09
354 0.08
355 0.08
356 0.05
357 0.05
358 0.05
359 0.04
360 0.04
361 0.04
362 0.04
363 0.05
364 0.06
365 0.05
366 0.05
367 0.05
368 0.05
369 0.06
370 0.05
371 0.04
372 0.05
373 0.05
374 0.04
375 0.04
376 0.04
377 0.03
378 0.04
379 0.05
380 0.07
381 0.07
382 0.1
383 0.11
384 0.16
385 0.19
386 0.18
387 0.21
388 0.19
389 0.21
390 0.19
391 0.19
392 0.15
393 0.12
394 0.16
395 0.13
396 0.14
397 0.12
398 0.12
399 0.13
400 0.15
401 0.18
402 0.21
403 0.27
404 0.26
405 0.29
406 0.31
407 0.33
408 0.36
409 0.36
410 0.31
411 0.26
412 0.27
413 0.24
414 0.22
415 0.19
416 0.15
417 0.11
418 0.1
419 0.11
420 0.08
421 0.09
422 0.09
423 0.08