Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A017SL86

Protein Details
Accession A0A017SL86    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
85-107VEKGSRSRPRYRDEPRRPARVYMBasic
NLS Segment(s)
PositionSequence
70-75RRRRRR
Subcellular Location(s) plas 17, extr 8
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAPILVRQSSDSGDTCPSTISGGGIAGIVIGSIAGTLLLIWLWKVCNLQGAWSGGESDVGYVPGSGTGGRRRRRRTSSPSMVEYVEKGSRSRPRYRDEPRRPARVYM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.17
4 0.16
5 0.14
6 0.13
7 0.11
8 0.08
9 0.07
10 0.07
11 0.06
12 0.06
13 0.04
14 0.04
15 0.03
16 0.02
17 0.02
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.03
29 0.04
30 0.05
31 0.05
32 0.06
33 0.09
34 0.09
35 0.11
36 0.13
37 0.14
38 0.13
39 0.12
40 0.13
41 0.09
42 0.09
43 0.08
44 0.06
45 0.05
46 0.05
47 0.05
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.07
54 0.14
55 0.22
56 0.3
57 0.39
58 0.47
59 0.56
60 0.64
61 0.71
62 0.73
63 0.76
64 0.79
65 0.76
66 0.73
67 0.66
68 0.59
69 0.5
70 0.41
71 0.35
72 0.27
73 0.22
74 0.19
75 0.24
76 0.31
77 0.37
78 0.46
79 0.48
80 0.53
81 0.62
82 0.72
83 0.76
84 0.79
85 0.84
86 0.83
87 0.86