Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A017SIR4

Protein Details
Accession A0A017SIR4   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-41LLWKTPWRISQPQKARQRKRLRSVDRVVDTHydrophilic
78-99FDKKEKTYRKGLHKLPKWTRVSBasic
NLS Segment(s)
Subcellular Location(s) mito 20.5, cyto_mito 11, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKPTSALFSGLLWKTPWRISQPQKARQRKRLRSVDRVVDTLSAALQRNGQSTKAVERWYAEMPREEEMVPKDKYTIFDKKEKTYRKGLHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.25
4 0.29
5 0.28
6 0.37
7 0.44
8 0.53
9 0.61
10 0.68
11 0.75
12 0.82
13 0.84
14 0.85
15 0.88
16 0.88
17 0.88
18 0.89
19 0.87
20 0.85
21 0.83
22 0.81
23 0.72
24 0.63
25 0.54
26 0.43
27 0.35
28 0.25
29 0.19
30 0.12
31 0.1
32 0.09
33 0.1
34 0.1
35 0.13
36 0.13
37 0.14
38 0.12
39 0.13
40 0.16
41 0.17
42 0.17
43 0.15
44 0.15
45 0.18
46 0.2
47 0.21
48 0.19
49 0.19
50 0.19
51 0.2
52 0.2
53 0.18
54 0.17
55 0.18
56 0.23
57 0.2
58 0.19
59 0.19
60 0.19
61 0.22
62 0.26
63 0.32
64 0.3
65 0.38
66 0.42
67 0.49
68 0.57
69 0.62
70 0.61
71 0.63
72 0.67
73 0.69
74 0.74
75 0.76
76 0.77
77 0.77
78 0.83
79 0.82
80 0.84
81 0.79
82 0.78
83 0.79
84 0.79
85 0.8
86 0.77
87 0.79