Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0HI61

Protein Details
Accession J0HI61    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
79-106EKVKKEYEEKMKRKKEKEKEKEKEKGEKBasic
NLS Segment(s)
PositionSequence
68-123KKKKEEMAREIEKVKKEYEEKMKRKKEKEKEKEKEKGEKDEGNKKKEDEDEKKAEK
Subcellular Location(s) mito 14.5, mito_nucl 13, nucl 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
KEGG cim:CIMG_04146  -  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MAQSLIPNRWHLRRVADSAARSCYICYKPSSSVLITPDNKDFFYICPIHLKDKGFCSPIIEEEEVAAKKKKEEMAREIEKVKKEYEEKMKRKKEKEKEKEKEKGEKDEGNKKKEDEDEKKAEKEKDEKINAIQAAHTGGVTGEDGPRIFTLHKNFYQMRIDKLRSMELAKRNRERMKDASFFPSAPKNDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.5
3 0.51
4 0.5
5 0.5
6 0.51
7 0.44
8 0.38
9 0.34
10 0.33
11 0.3
12 0.28
13 0.29
14 0.29
15 0.31
16 0.35
17 0.38
18 0.32
19 0.33
20 0.33
21 0.38
22 0.36
23 0.36
24 0.36
25 0.34
26 0.32
27 0.3
28 0.27
29 0.19
30 0.23
31 0.21
32 0.18
33 0.24
34 0.26
35 0.29
36 0.33
37 0.34
38 0.31
39 0.35
40 0.38
41 0.32
42 0.31
43 0.29
44 0.26
45 0.25
46 0.27
47 0.22
48 0.18
49 0.16
50 0.2
51 0.17
52 0.18
53 0.19
54 0.15
55 0.15
56 0.19
57 0.24
58 0.26
59 0.31
60 0.36
61 0.42
62 0.46
63 0.48
64 0.48
65 0.47
66 0.44
67 0.4
68 0.35
69 0.3
70 0.27
71 0.31
72 0.38
73 0.45
74 0.51
75 0.59
76 0.68
77 0.72
78 0.78
79 0.82
80 0.81
81 0.82
82 0.84
83 0.85
84 0.85
85 0.86
86 0.85
87 0.81
88 0.8
89 0.72
90 0.69
91 0.62
92 0.58
93 0.54
94 0.56
95 0.57
96 0.52
97 0.51
98 0.44
99 0.42
100 0.43
101 0.48
102 0.44
103 0.45
104 0.5
105 0.51
106 0.54
107 0.56
108 0.52
109 0.47
110 0.46
111 0.45
112 0.46
113 0.46
114 0.44
115 0.4
116 0.43
117 0.4
118 0.34
119 0.27
120 0.18
121 0.16
122 0.14
123 0.12
124 0.07
125 0.06
126 0.06
127 0.06
128 0.07
129 0.06
130 0.07
131 0.07
132 0.08
133 0.08
134 0.09
135 0.1
136 0.15
137 0.21
138 0.27
139 0.29
140 0.35
141 0.36
142 0.4
143 0.47
144 0.45
145 0.46
146 0.47
147 0.48
148 0.45
149 0.46
150 0.45
151 0.38
152 0.41
153 0.41
154 0.41
155 0.48
156 0.53
157 0.59
158 0.65
159 0.69
160 0.7
161 0.69
162 0.69
163 0.68
164 0.65
165 0.6
166 0.57
167 0.53
168 0.48
169 0.45
170 0.45