Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A017SDY1

Protein Details
Accession A0A017SDY1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
16-40VIDKRRGLKTKPRLNEKKRNLRDFPBasic
NLS Segment(s)
PositionSequence
19-34KRRGLKTKPRLNEKKR
Subcellular Location(s) plas 17, mito 4, E.R. 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRTSTGETRRRECSSVIDKRRGLKTKPRLNEKKRNLRDFPNGVFYYISWMANHVMICFSLSSLHLFVMVYIVYLAVCFLFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.55
3 0.58
4 0.59
5 0.58
6 0.62
7 0.7
8 0.67
9 0.62
10 0.62
11 0.65
12 0.66
13 0.71
14 0.76
15 0.78
16 0.81
17 0.86
18 0.86
19 0.87
20 0.86
21 0.86
22 0.78
23 0.74
24 0.73
25 0.66
26 0.58
27 0.53
28 0.45
29 0.37
30 0.33
31 0.27
32 0.24
33 0.2
34 0.19
35 0.11
36 0.12
37 0.12
38 0.14
39 0.14
40 0.09
41 0.08
42 0.08
43 0.09
44 0.07
45 0.07
46 0.06
47 0.07
48 0.08
49 0.09
50 0.09
51 0.08
52 0.08
53 0.08
54 0.08
55 0.07
56 0.06
57 0.05
58 0.05
59 0.04
60 0.05
61 0.05