Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A017SKA7

Protein Details
Accession A0A017SKA7    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
50-75VTREIGPSRNKTRNKRNNNERISNLNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, cyto 4.5, cyto_nucl 4.5, nucl 3.5
Family & Domain DBs
Amino Acid Sequences MDSFQCRYGIYGIYTTTWFLKRVGHYHFILPRAYGASLKASLSDCEDDIVTREIGPSRNKTRNKRNNNERISNLNNRFQAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.18
4 0.17
5 0.16
6 0.16
7 0.19
8 0.22
9 0.26
10 0.3
11 0.31
12 0.31
13 0.35
14 0.38
15 0.35
16 0.32
17 0.27
18 0.22
19 0.19
20 0.18
21 0.13
22 0.1
23 0.1
24 0.1
25 0.1
26 0.1
27 0.1
28 0.1
29 0.11
30 0.11
31 0.09
32 0.09
33 0.09
34 0.08
35 0.09
36 0.1
37 0.08
38 0.08
39 0.09
40 0.1
41 0.14
42 0.19
43 0.24
44 0.31
45 0.4
46 0.49
47 0.58
48 0.68
49 0.75
50 0.81
51 0.85
52 0.88
53 0.89
54 0.9
55 0.88
56 0.81
57 0.78
58 0.75
59 0.74
60 0.69
61 0.66