Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E1RY20

Protein Details
Accession A0A0E1RY20    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-34AAKIETKKQSPRKAPEKAMFLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 8.5, cysk 6, mito 5
Family & Domain DBs
KEGG cim:CIMG_00226  -  
Amino Acid Sequences MMGVDETTVGLLLAAKIETKKQSPRKAPEKAMFLSRSLGTDHPPPSLWRAEALTFAKRHQRHGLVCRPRKGLHVFRAMQGYSRKRAVIVMGSPNFCTVVESYAILRSDRFLATGIETLTGTIEGIFEKKMMYIKSCSPTSSTTDELQLQETNKDQRRSHMGTAPRMTASCELRRCLVDQPRLAGWI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.08
3 0.09
4 0.14
5 0.18
6 0.23
7 0.34
8 0.43
9 0.53
10 0.61
11 0.7
12 0.75
13 0.8
14 0.83
15 0.8
16 0.77
17 0.7
18 0.67
19 0.59
20 0.5
21 0.44
22 0.35
23 0.29
24 0.25
25 0.23
26 0.19
27 0.23
28 0.23
29 0.22
30 0.22
31 0.23
32 0.24
33 0.26
34 0.23
35 0.19
36 0.2
37 0.19
38 0.23
39 0.24
40 0.25
41 0.23
42 0.25
43 0.32
44 0.31
45 0.36
46 0.37
47 0.41
48 0.43
49 0.5
50 0.58
51 0.6
52 0.65
53 0.66
54 0.64
55 0.58
56 0.57
57 0.56
58 0.54
59 0.5
60 0.52
61 0.47
62 0.45
63 0.47
64 0.42
65 0.38
66 0.37
67 0.34
68 0.29
69 0.29
70 0.27
71 0.24
72 0.25
73 0.22
74 0.17
75 0.16
76 0.19
77 0.2
78 0.21
79 0.2
80 0.2
81 0.19
82 0.16
83 0.15
84 0.08
85 0.07
86 0.07
87 0.07
88 0.08
89 0.1
90 0.1
91 0.09
92 0.09
93 0.09
94 0.1
95 0.1
96 0.1
97 0.08
98 0.08
99 0.09
100 0.11
101 0.1
102 0.09
103 0.09
104 0.08
105 0.07
106 0.07
107 0.06
108 0.04
109 0.04
110 0.04
111 0.05
112 0.05
113 0.05
114 0.05
115 0.06
116 0.1
117 0.11
118 0.13
119 0.16
120 0.21
121 0.27
122 0.28
123 0.28
124 0.27
125 0.29
126 0.3
127 0.31
128 0.29
129 0.24
130 0.26
131 0.28
132 0.26
133 0.26
134 0.24
135 0.21
136 0.2
137 0.23
138 0.29
139 0.33
140 0.39
141 0.38
142 0.42
143 0.49
144 0.53
145 0.54
146 0.52
147 0.52
148 0.54
149 0.57
150 0.54
151 0.47
152 0.41
153 0.38
154 0.37
155 0.36
156 0.36
157 0.36
158 0.36
159 0.38
160 0.39
161 0.38
162 0.42
163 0.45
164 0.46
165 0.45
166 0.47