Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A017SDQ6

Protein Details
Accession A0A017SDQ6    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
86-122AATKIEKASRQQRKQRKNRSKKFRGTAKTKGPKKSKDBasic
NLS Segment(s)
PositionSequence
86-122AATKIEKASRQQRKQRKNRSKKFRGTAKTKGPKKSKD
Subcellular Location(s) mito 20, extr 4, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MIRKAKFIKLILLSSDVLHPNRANVSKDELRDKLSGLYKANKDEVSVFGFRTQYGGGKSTGFALVYDSAEALKKFEPHHRLVRIGAATKIEKASRQQRKQRKNRSKKFRGTAKTKGPKKSKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.26
4 0.23
5 0.24
6 0.22
7 0.21
8 0.26
9 0.29
10 0.27
11 0.25
12 0.32
13 0.34
14 0.37
15 0.41
16 0.37
17 0.37
18 0.35
19 0.34
20 0.31
21 0.31
22 0.31
23 0.28
24 0.33
25 0.32
26 0.34
27 0.36
28 0.31
29 0.27
30 0.25
31 0.24
32 0.2
33 0.19
34 0.16
35 0.16
36 0.16
37 0.15
38 0.14
39 0.13
40 0.11
41 0.11
42 0.12
43 0.11
44 0.11
45 0.11
46 0.11
47 0.11
48 0.09
49 0.07
50 0.07
51 0.07
52 0.07
53 0.07
54 0.06
55 0.06
56 0.07
57 0.07
58 0.07
59 0.08
60 0.1
61 0.12
62 0.2
63 0.25
64 0.29
65 0.37
66 0.39
67 0.4
68 0.38
69 0.41
70 0.36
71 0.32
72 0.28
73 0.24
74 0.22
75 0.21
76 0.23
77 0.19
78 0.19
79 0.25
80 0.34
81 0.42
82 0.51
83 0.59
84 0.68
85 0.78
86 0.87
87 0.91
88 0.92
89 0.93
90 0.94
91 0.95
92 0.95
93 0.94
94 0.93
95 0.92
96 0.91
97 0.88
98 0.87
99 0.87
100 0.87
101 0.84
102 0.84