Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A017S4Z8

Protein Details
Accession A0A017S4Z8    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
41-61TSNLRSRRSSRRPPTPNRMAGHydrophilic
64-91SGSGAKRRSKSRSRAPSKSRSRERRVGDBasic
NLS Segment(s)
PositionSequence
46-89SRRSSRRPPTPNRMAGAHSGSGAKRRSKSRSRAPSKSRSRERRV
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MTDNLAAEQAANLPRRRRASSGERDDRLQRQPADTRTTINTSNLRSRRSSRRPPTPNRMAGAHSGSGAKRRSKSRSRAPSKSRSRERRVGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.41
3 0.45
4 0.45
5 0.47
6 0.53
7 0.59
8 0.65
9 0.67
10 0.63
11 0.62
12 0.64
13 0.61
14 0.56
15 0.52
16 0.42
17 0.38
18 0.42
19 0.42
20 0.43
21 0.38
22 0.36
23 0.32
24 0.33
25 0.3
26 0.28
27 0.27
28 0.24
29 0.32
30 0.33
31 0.33
32 0.32
33 0.37
34 0.43
35 0.49
36 0.57
37 0.58
38 0.65
39 0.72
40 0.78
41 0.83
42 0.81
43 0.77
44 0.69
45 0.62
46 0.53
47 0.47
48 0.41
49 0.31
50 0.23
51 0.2
52 0.18
53 0.22
54 0.25
55 0.27
56 0.3
57 0.37
58 0.45
59 0.53
60 0.62
61 0.67
62 0.74
63 0.78
64 0.83
65 0.85
66 0.87
67 0.88
68 0.89
69 0.89
70 0.89
71 0.88