Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A017SBG9

Protein Details
Accession A0A017SBG9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
67-86AERMKKRTSIDRMKQRPYYPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7, plas 5, extr 4, golg 4, E.R. 3, pero 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKALGLWMFVSKFIKLVGHYIRYPVDVLLLPVSILFGYLHGIIKIYAVLTLNVTAWGSRDGADDYDAERMKKRTSIDRMKQRPYYPNFVTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.2
4 0.23
5 0.26
6 0.26
7 0.28
8 0.28
9 0.27
10 0.27
11 0.2
12 0.16
13 0.12
14 0.12
15 0.1
16 0.09
17 0.08
18 0.07
19 0.07
20 0.05
21 0.05
22 0.04
23 0.04
24 0.05
25 0.06
26 0.06
27 0.06
28 0.06
29 0.06
30 0.06
31 0.06
32 0.04
33 0.04
34 0.04
35 0.05
36 0.05
37 0.05
38 0.05
39 0.06
40 0.06
41 0.05
42 0.05
43 0.06
44 0.06
45 0.07
46 0.08
47 0.08
48 0.09
49 0.1
50 0.1
51 0.09
52 0.15
53 0.16
54 0.16
55 0.19
56 0.21
57 0.22
58 0.26
59 0.29
60 0.32
61 0.41
62 0.52
63 0.58
64 0.67
65 0.74
66 0.79
67 0.83
68 0.79
69 0.79
70 0.75
71 0.74