Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E1S4F3

Protein Details
Accession A0A0E1S4F3    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
203-267VTAHPNREPGKKRNRASKRTRERRRGQGRSDVADVEKRSLNKEKTRREKKRMKRPRKQKKNKPQDBasic
NLS Segment(s)
PositionSequence
209-265REPGKKRNRASKRTRERRRGQGRSDVADVEKRSLNKEKTRREKKRMKRPRKQKKNKP
Subcellular Location(s) nucl 19.5, cyto_nucl 14, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011082  Exosome-assoc_fac/DNA_repair  
IPR007146  Sas10/Utp3/C1D  
Gene Ontology GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
KEGG cim:CIMG_00430  -  
Pfam View protein in Pfam  
PF04000  Sas10_Utp3  
Amino Acid Sequences MHNSAAMEMTDLTPLGDQLEGDIDELEEVLEPLLSQTLSTATQKMTVMDKAKLHVLITYTIESLLFSYLRLQGVNAKEHSVFKELTRVKQYFAKIKNLETVPEKPTMTLDKQAAARFIKHGLAGNDKIDLERAEREAKERAMAQLRAAQLARKQGETVTAATPADSLPQKRPAEDEEESENDDGDTGNEYEASSNTGEGDHEVTAHPNREPGKKRNRASKRTRERRRGQGRSDVADVEKRSLNKEKTRREKKRMKRPRKQKKNKPQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.07
4 0.07
5 0.07
6 0.09
7 0.09
8 0.09
9 0.09
10 0.08
11 0.08
12 0.08
13 0.07
14 0.05
15 0.05
16 0.04
17 0.04
18 0.04
19 0.04
20 0.06
21 0.05
22 0.05
23 0.05
24 0.07
25 0.1
26 0.11
27 0.13
28 0.12
29 0.16
30 0.16
31 0.18
32 0.19
33 0.22
34 0.24
35 0.27
36 0.28
37 0.27
38 0.29
39 0.28
40 0.25
41 0.21
42 0.19
43 0.17
44 0.18
45 0.18
46 0.15
47 0.14
48 0.14
49 0.12
50 0.11
51 0.1
52 0.07
53 0.06
54 0.08
55 0.11
56 0.11
57 0.11
58 0.11
59 0.16
60 0.19
61 0.23
62 0.22
63 0.22
64 0.23
65 0.24
66 0.26
67 0.23
68 0.21
69 0.17
70 0.26
71 0.26
72 0.3
73 0.36
74 0.34
75 0.33
76 0.38
77 0.41
78 0.4
79 0.42
80 0.46
81 0.4
82 0.41
83 0.45
84 0.4
85 0.39
86 0.35
87 0.35
88 0.28
89 0.29
90 0.28
91 0.22
92 0.23
93 0.24
94 0.22
95 0.22
96 0.2
97 0.2
98 0.23
99 0.23
100 0.25
101 0.22
102 0.21
103 0.18
104 0.18
105 0.16
106 0.14
107 0.16
108 0.14
109 0.18
110 0.18
111 0.17
112 0.17
113 0.16
114 0.15
115 0.13
116 0.12
117 0.09
118 0.09
119 0.1
120 0.12
121 0.12
122 0.15
123 0.17
124 0.16
125 0.16
126 0.16
127 0.17
128 0.19
129 0.19
130 0.18
131 0.19
132 0.19
133 0.2
134 0.19
135 0.17
136 0.15
137 0.21
138 0.21
139 0.18
140 0.18
141 0.16
142 0.19
143 0.19
144 0.18
145 0.12
146 0.13
147 0.12
148 0.12
149 0.12
150 0.09
151 0.11
152 0.11
153 0.12
154 0.15
155 0.24
156 0.25
157 0.25
158 0.27
159 0.26
160 0.31
161 0.3
162 0.29
163 0.25
164 0.26
165 0.27
166 0.25
167 0.22
168 0.15
169 0.14
170 0.11
171 0.07
172 0.08
173 0.06
174 0.06
175 0.07
176 0.07
177 0.07
178 0.08
179 0.09
180 0.07
181 0.07
182 0.07
183 0.07
184 0.08
185 0.08
186 0.09
187 0.07
188 0.08
189 0.08
190 0.11
191 0.14
192 0.16
193 0.15
194 0.18
195 0.22
196 0.31
197 0.38
198 0.44
199 0.53
200 0.61
201 0.68
202 0.74
203 0.81
204 0.82
205 0.86
206 0.87
207 0.88
208 0.89
209 0.93
210 0.93
211 0.92
212 0.92
213 0.93
214 0.91
215 0.86
216 0.85
217 0.8
218 0.74
219 0.67
220 0.59
221 0.5
222 0.47
223 0.41
224 0.35
225 0.33
226 0.29
227 0.33
228 0.39
229 0.45
230 0.49
231 0.58
232 0.65
233 0.72
234 0.83
235 0.88
236 0.89
237 0.92
238 0.93
239 0.94
240 0.95
241 0.95
242 0.95
243 0.95
244 0.96
245 0.96
246 0.97
247 0.97