Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E1S097

Protein Details
Accession A0A0E1S097   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
7-31TRVFFRSSFRYRRAHRCRRLTMLAVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, plas 6, E.R. 2, cyto 1, extr 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR011330  Glyco_hydro/deAcase_b/a-brl  
IPR002509  NODB_dom  
Gene Ontology GO:0016020  C:membrane  
GO:0016810  F:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds  
GO:0005975  P:carbohydrate metabolic process  
KEGG cim:CIMG_02314  -  
Pfam View protein in Pfam  
PF01522  Polysacc_deac_1  
PROSITE View protein in PROSITE  
PS51677  NODB  
CDD cd10958  CE4_NodB_like_2  
Amino Acid Sequences MLLRPLTRVFFRSSFRYRRAHRCRRLTMLAVLTIFIFLTTPFYFVYKPPQFIIRYLQRRGPDVLWHVSTSSKVVALTIDDTPSQYTSEMVQILKENDARATWFVIGNQVPGREKVLDELVQNGNELANHAMRDETSKSLSDDVLREQIVTVEGMIRQAYASVDREEDFPKYFRPGGGFFNRRMQDLLARLGYRLVLGDIYPHDPFVSYWRVNARHILSMLHPGGIIICHDRRSWTPPMLREVLPKIRRQGYRIVTVTELLEEHKREMIMTSRIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.57
3 0.64
4 0.66
5 0.72
6 0.79
7 0.82
8 0.83
9 0.84
10 0.86
11 0.85
12 0.83
13 0.76
14 0.72
15 0.64
16 0.57
17 0.46
18 0.38
19 0.3
20 0.23
21 0.18
22 0.11
23 0.08
24 0.05
25 0.09
26 0.09
27 0.1
28 0.11
29 0.12
30 0.14
31 0.15
32 0.25
33 0.25
34 0.28
35 0.28
36 0.34
37 0.34
38 0.35
39 0.43
40 0.42
41 0.45
42 0.47
43 0.5
44 0.46
45 0.48
46 0.49
47 0.42
48 0.37
49 0.35
50 0.36
51 0.32
52 0.3
53 0.28
54 0.25
55 0.24
56 0.2
57 0.15
58 0.11
59 0.09
60 0.09
61 0.09
62 0.09
63 0.11
64 0.1
65 0.1
66 0.1
67 0.1
68 0.11
69 0.11
70 0.11
71 0.09
72 0.09
73 0.08
74 0.1
75 0.12
76 0.11
77 0.11
78 0.12
79 0.13
80 0.15
81 0.15
82 0.14
83 0.12
84 0.13
85 0.13
86 0.12
87 0.12
88 0.1
89 0.1
90 0.09
91 0.12
92 0.12
93 0.13
94 0.13
95 0.14
96 0.14
97 0.14
98 0.16
99 0.13
100 0.13
101 0.12
102 0.14
103 0.14
104 0.13
105 0.16
106 0.15
107 0.15
108 0.15
109 0.13
110 0.11
111 0.09
112 0.09
113 0.07
114 0.06
115 0.06
116 0.06
117 0.06
118 0.06
119 0.09
120 0.09
121 0.1
122 0.1
123 0.11
124 0.11
125 0.12
126 0.13
127 0.12
128 0.11
129 0.11
130 0.12
131 0.11
132 0.11
133 0.1
134 0.1
135 0.09
136 0.08
137 0.06
138 0.05
139 0.05
140 0.05
141 0.05
142 0.05
143 0.04
144 0.05
145 0.05
146 0.06
147 0.08
148 0.08
149 0.09
150 0.1
151 0.12
152 0.13
153 0.14
154 0.14
155 0.14
156 0.14
157 0.17
158 0.17
159 0.16
160 0.18
161 0.18
162 0.23
163 0.32
164 0.33
165 0.32
166 0.4
167 0.4
168 0.37
169 0.36
170 0.31
171 0.26
172 0.25
173 0.27
174 0.21
175 0.2
176 0.19
177 0.19
178 0.18
179 0.13
180 0.11
181 0.08
182 0.05
183 0.05
184 0.07
185 0.08
186 0.11
187 0.11
188 0.11
189 0.11
190 0.11
191 0.12
192 0.14
193 0.2
194 0.17
195 0.2
196 0.27
197 0.3
198 0.31
199 0.36
200 0.34
201 0.31
202 0.31
203 0.3
204 0.24
205 0.29
206 0.28
207 0.22
208 0.19
209 0.15
210 0.15
211 0.14
212 0.14
213 0.12
214 0.13
215 0.15
216 0.16
217 0.19
218 0.22
219 0.28
220 0.33
221 0.35
222 0.4
223 0.42
224 0.48
225 0.5
226 0.48
227 0.49
228 0.5
229 0.52
230 0.51
231 0.52
232 0.53
233 0.57
234 0.59
235 0.56
236 0.59
237 0.54
238 0.59
239 0.56
240 0.51
241 0.44
242 0.41
243 0.39
244 0.3
245 0.24
246 0.18
247 0.21
248 0.2
249 0.2
250 0.21
251 0.21
252 0.2
253 0.23
254 0.26