Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D8JU06

Protein Details
Accession A0A0D8JU06    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
12-36QDEHSPMSTKKKPGRKPSAVKEEPAHydrophilic
NLS Segment(s)
PositionSequence
21-28KKKPGRKP
Subcellular Location(s) nucl 21, mito 5
Family & Domain DBs
KEGG cim:CIMG_12976  -  
Amino Acid Sequences MAPQTRKLAAAQDEHSPMSTKKKPGRKPSAVKEEPAMMGDTLCGRCLTFVYTAHIEKPCSRKQGTAKACTNCAGDKKACAPVPSELQKEVAALLSDHDDFLRLKNATLREELKASMAEQAAGLSELLAKMAPPSVRTDESPPPPPFNAEVGAATLAALEKLVSIQAEQKELAEHTFRSVKNIERTLADIRQDLKSNCLPSAKKRKAEETVYESAAKIGRFAAALPSAASAPPPPLPHSDHAFSLRSVAAEYLCVGPVSNWRQWSRFARKYDQAARMGSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.36
3 0.32
4 0.29
5 0.33
6 0.37
7 0.41
8 0.47
9 0.56
10 0.65
11 0.73
12 0.82
13 0.83
14 0.87
15 0.88
16 0.9
17 0.84
18 0.76
19 0.68
20 0.61
21 0.51
22 0.42
23 0.33
24 0.21
25 0.18
26 0.16
27 0.17
28 0.13
29 0.13
30 0.12
31 0.11
32 0.11
33 0.12
34 0.13
35 0.12
36 0.13
37 0.17
38 0.21
39 0.23
40 0.27
41 0.28
42 0.28
43 0.31
44 0.38
45 0.39
46 0.42
47 0.42
48 0.45
49 0.51
50 0.59
51 0.61
52 0.63
53 0.65
54 0.61
55 0.61
56 0.56
57 0.5
58 0.43
59 0.39
60 0.34
61 0.28
62 0.27
63 0.29
64 0.33
65 0.33
66 0.3
67 0.29
68 0.27
69 0.33
70 0.36
71 0.34
72 0.28
73 0.28
74 0.27
75 0.25
76 0.22
77 0.15
78 0.1
79 0.08
80 0.08
81 0.08
82 0.08
83 0.08
84 0.08
85 0.08
86 0.08
87 0.09
88 0.14
89 0.12
90 0.13
91 0.17
92 0.2
93 0.21
94 0.24
95 0.25
96 0.21
97 0.22
98 0.21
99 0.18
100 0.16
101 0.14
102 0.14
103 0.12
104 0.1
105 0.09
106 0.08
107 0.07
108 0.07
109 0.07
110 0.03
111 0.04
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.06
118 0.06
119 0.06
120 0.1
121 0.13
122 0.14
123 0.15
124 0.2
125 0.24
126 0.27
127 0.34
128 0.33
129 0.32
130 0.31
131 0.31
132 0.28
133 0.23
134 0.21
135 0.14
136 0.12
137 0.1
138 0.1
139 0.09
140 0.07
141 0.06
142 0.04
143 0.03
144 0.03
145 0.03
146 0.02
147 0.02
148 0.03
149 0.03
150 0.04
151 0.08
152 0.09
153 0.11
154 0.11
155 0.11
156 0.12
157 0.12
158 0.13
159 0.11
160 0.1
161 0.11
162 0.17
163 0.17
164 0.2
165 0.22
166 0.26
167 0.31
168 0.33
169 0.32
170 0.27
171 0.3
172 0.31
173 0.31
174 0.27
175 0.23
176 0.23
177 0.24
178 0.27
179 0.24
180 0.25
181 0.26
182 0.27
183 0.26
184 0.3
185 0.29
186 0.35
187 0.47
188 0.49
189 0.53
190 0.55
191 0.6
192 0.61
193 0.65
194 0.62
195 0.58
196 0.55
197 0.5
198 0.47
199 0.39
200 0.34
201 0.31
202 0.23
203 0.16
204 0.13
205 0.11
206 0.1
207 0.1
208 0.12
209 0.1
210 0.11
211 0.11
212 0.11
213 0.11
214 0.11
215 0.11
216 0.08
217 0.1
218 0.13
219 0.15
220 0.16
221 0.2
222 0.25
223 0.29
224 0.34
225 0.34
226 0.34
227 0.36
228 0.35
229 0.31
230 0.29
231 0.25
232 0.2
233 0.18
234 0.16
235 0.12
236 0.11
237 0.12
238 0.11
239 0.1
240 0.1
241 0.1
242 0.1
243 0.18
244 0.23
245 0.26
246 0.31
247 0.34
248 0.36
249 0.44
250 0.53
251 0.56
252 0.58
253 0.61
254 0.63
255 0.68
256 0.75
257 0.77
258 0.75
259 0.69