Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3KJV2

Protein Details
Accession J3KJV2    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-24LDPYWRTHANKDKKERERPMESPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, nucl 8.5, cyto_nucl 8, cyto 6.5
Family & Domain DBs
KEGG cim:CIMG_01752  -  
Amino Acid Sequences MLDPYWRTHANKDKKERERPMESPHRRGITGNVGKFQRRQTLPNYVEDERGPVLHRPGLLGAKWAPGSPPPSWHFPGLECTVVTGPPAKPPIRGLAPDRGAKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.87
3 0.88
4 0.86
5 0.84
6 0.79
7 0.78
8 0.79
9 0.76
10 0.73
11 0.7
12 0.64
13 0.56
14 0.52
15 0.46
16 0.46
17 0.46
18 0.4
19 0.38
20 0.38
21 0.39
22 0.42
23 0.41
24 0.39
25 0.33
26 0.35
27 0.35
28 0.43
29 0.42
30 0.44
31 0.45
32 0.38
33 0.37
34 0.34
35 0.31
36 0.2
37 0.19
38 0.15
39 0.11
40 0.11
41 0.11
42 0.11
43 0.1
44 0.11
45 0.12
46 0.11
47 0.12
48 0.11
49 0.12
50 0.13
51 0.12
52 0.11
53 0.12
54 0.16
55 0.15
56 0.2
57 0.21
58 0.27
59 0.29
60 0.3
61 0.28
62 0.26
63 0.3
64 0.27
65 0.26
66 0.2
67 0.19
68 0.18
69 0.17
70 0.17
71 0.15
72 0.13
73 0.17
74 0.24
75 0.23
76 0.24
77 0.27
78 0.33
79 0.35
80 0.39
81 0.38
82 0.42
83 0.47