Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A017SJK0

Protein Details
Accession A0A017SJK0   
Localization Confidence High
Confidence Score 18.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPFFWRKKNQFKPSARNYHSVEHydrophilic
108-139PKTGASCKSTRQRRNPRPPRPPLPRPPRTTSLHydrophilic
144-173VPCPSRTARGPRQQPPPKQRDDQRLKTMCHHydrophilic
NLS Segment(s)
PositionSequence
119-133QRRNPRPPRPPLPRP
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, mito 3
Family & Domain DBs
Amino Acid Sequences MPFFWRKKNQFKPSARNYHSVEQLSTYPPHQNNDSIHSGSSIPDFHRSSDLRGGDPRTDRQPDRQQRSLHRPSQSQSHSQAQASQEPIPEPASIRRTQTAHLFQDPEPKTGASCKSTRQRRNPRPPRPPLPRPPRTTSLVFWAVPCPSRTARGPRQQPPPKQRDDQRLKTMCH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.84
3 0.81
4 0.76
5 0.72
6 0.69
7 0.6
8 0.5
9 0.42
10 0.4
11 0.35
12 0.31
13 0.27
14 0.28
15 0.28
16 0.31
17 0.31
18 0.33
19 0.32
20 0.36
21 0.39
22 0.32
23 0.3
24 0.27
25 0.25
26 0.21
27 0.2
28 0.16
29 0.13
30 0.19
31 0.19
32 0.19
33 0.25
34 0.25
35 0.27
36 0.32
37 0.32
38 0.27
39 0.3
40 0.32
41 0.3
42 0.33
43 0.33
44 0.32
45 0.37
46 0.36
47 0.41
48 0.49
49 0.55
50 0.6
51 0.63
52 0.62
53 0.64
54 0.72
55 0.72
56 0.67
57 0.61
58 0.56
59 0.51
60 0.55
61 0.5
62 0.45
63 0.41
64 0.4
65 0.37
66 0.35
67 0.36
68 0.29
69 0.28
70 0.26
71 0.22
72 0.17
73 0.15
74 0.16
75 0.14
76 0.12
77 0.11
78 0.13
79 0.16
80 0.17
81 0.18
82 0.21
83 0.2
84 0.22
85 0.27
86 0.29
87 0.28
88 0.29
89 0.31
90 0.28
91 0.37
92 0.37
93 0.31
94 0.26
95 0.23
96 0.22
97 0.23
98 0.26
99 0.2
100 0.2
101 0.26
102 0.35
103 0.45
104 0.54
105 0.61
106 0.69
107 0.77
108 0.87
109 0.9
110 0.92
111 0.92
112 0.93
113 0.92
114 0.9
115 0.89
116 0.89
117 0.88
118 0.87
119 0.83
120 0.81
121 0.76
122 0.71
123 0.65
124 0.56
125 0.52
126 0.48
127 0.41
128 0.34
129 0.32
130 0.29
131 0.28
132 0.27
133 0.24
134 0.21
135 0.25
136 0.3
137 0.38
138 0.45
139 0.53
140 0.62
141 0.65
142 0.75
143 0.8
144 0.84
145 0.86
146 0.85
147 0.82
148 0.83
149 0.83
150 0.83
151 0.84
152 0.83
153 0.83