Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A017S339

Protein Details
Accession A0A017S339    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
40-69VGRIRSDKKDEDRNKNKKRREGRVEMRAPIBasic
NLS Segment(s)
PositionSequence
44-66RSDKKDEDRNKNKKRREGRVEMR
Subcellular Location(s) nucl 16, mito 8, cyto 2
Family & Domain DBs
Amino Acid Sequences MPSTYGWIWPKDPRPGNPSHWPRRWRLFDIFRNRGPDIFVGRIRSDKKDEDRNKNKKRREGRVEMRAPIQQRPPRNRECAWAGWGNVHPTSTNVTGSGDKGGMKTKYAYSSALPWTTRKPNERYDFRTKRYTVPDSGTWSRVEYCSGDLEGHGWKRKKHVIPVRYWDKNGEMYPAGYWHDVVYGGHARCCDCG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.6
3 0.63
4 0.66
5 0.7
6 0.7
7 0.72
8 0.72
9 0.73
10 0.77
11 0.77
12 0.73
13 0.72
14 0.71
15 0.73
16 0.77
17 0.77
18 0.71
19 0.69
20 0.64
21 0.55
22 0.46
23 0.4
24 0.34
25 0.32
26 0.3
27 0.28
28 0.28
29 0.34
30 0.35
31 0.36
32 0.36
33 0.38
34 0.43
35 0.5
36 0.58
37 0.63
38 0.71
39 0.78
40 0.84
41 0.86
42 0.87
43 0.86
44 0.87
45 0.86
46 0.85
47 0.84
48 0.83
49 0.84
50 0.8
51 0.73
52 0.66
53 0.59
54 0.51
55 0.45
56 0.44
57 0.39
58 0.42
59 0.49
60 0.53
61 0.56
62 0.6
63 0.57
64 0.53
65 0.52
66 0.46
67 0.41
68 0.36
69 0.3
70 0.26
71 0.26
72 0.23
73 0.19
74 0.17
75 0.12
76 0.11
77 0.14
78 0.12
79 0.11
80 0.09
81 0.1
82 0.11
83 0.11
84 0.11
85 0.09
86 0.08
87 0.08
88 0.12
89 0.11
90 0.11
91 0.12
92 0.13
93 0.15
94 0.16
95 0.16
96 0.14
97 0.17
98 0.19
99 0.2
100 0.2
101 0.19
102 0.23
103 0.29
104 0.34
105 0.36
106 0.39
107 0.45
108 0.53
109 0.59
110 0.62
111 0.65
112 0.68
113 0.67
114 0.7
115 0.63
116 0.6
117 0.61
118 0.58
119 0.5
120 0.47
121 0.45
122 0.45
123 0.45
124 0.41
125 0.34
126 0.3
127 0.28
128 0.24
129 0.22
130 0.16
131 0.15
132 0.15
133 0.15
134 0.13
135 0.12
136 0.13
137 0.16
138 0.2
139 0.27
140 0.28
141 0.3
142 0.37
143 0.46
144 0.51
145 0.56
146 0.61
147 0.62
148 0.68
149 0.76
150 0.79
151 0.75
152 0.71
153 0.63
154 0.57
155 0.53
156 0.45
157 0.39
158 0.3
159 0.26
160 0.25
161 0.24
162 0.23
163 0.18
164 0.17
165 0.13
166 0.13
167 0.12
168 0.12
169 0.15
170 0.2
171 0.2
172 0.22
173 0.23