Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A017SH93

Protein Details
Accession A0A017SH93    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
135-163DTQEHTKKALNNPKKKKEKKISSFCWINSHydrophilic
NLS Segment(s)
PositionSequence
145-154NNPKKKKEKK
Subcellular Location(s) mito 16.5, mito_nucl 13.333, nucl 9, cyto_nucl 5.833
Family & Domain DBs
Amino Acid Sequences MGRRMDRVPLTGFLAVRERFKVRPSLGWVPTKVCESCYPKMVRDGSNSGPEPVDESRIQDRRAFCDRRRIGMKFRTFPVLRAPYCLPKTSPRAAQRSPVLVFVVTVENEKSADEPVVNCHARRWAVEQNKNALLDTQEHTKKALNNPKKKKEKKISSFCWINSVRNEYADFPESNFSDGDPQPFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.28
4 0.3
5 0.3
6 0.29
7 0.32
8 0.38
9 0.34
10 0.38
11 0.43
12 0.48
13 0.51
14 0.55
15 0.53
16 0.49
17 0.48
18 0.46
19 0.38
20 0.32
21 0.34
22 0.34
23 0.36
24 0.4
25 0.41
26 0.38
27 0.45
28 0.47
29 0.42
30 0.4
31 0.42
32 0.38
33 0.42
34 0.41
35 0.35
36 0.31
37 0.27
38 0.25
39 0.21
40 0.22
41 0.15
42 0.18
43 0.25
44 0.28
45 0.3
46 0.31
47 0.31
48 0.33
49 0.42
50 0.45
51 0.39
52 0.46
53 0.47
54 0.5
55 0.55
56 0.52
57 0.51
58 0.53
59 0.58
60 0.51
61 0.5
62 0.51
63 0.45
64 0.43
65 0.44
66 0.42
67 0.35
68 0.35
69 0.35
70 0.35
71 0.36
72 0.36
73 0.29
74 0.27
75 0.33
76 0.32
77 0.38
78 0.37
79 0.41
80 0.41
81 0.44
82 0.41
83 0.4
84 0.37
85 0.3
86 0.25
87 0.18
88 0.17
89 0.13
90 0.12
91 0.08
92 0.08
93 0.07
94 0.07
95 0.07
96 0.07
97 0.07
98 0.06
99 0.06
100 0.06
101 0.06
102 0.09
103 0.16
104 0.17
105 0.16
106 0.17
107 0.2
108 0.21
109 0.22
110 0.25
111 0.27
112 0.36
113 0.43
114 0.46
115 0.48
116 0.5
117 0.49
118 0.43
119 0.35
120 0.26
121 0.23
122 0.21
123 0.24
124 0.24
125 0.24
126 0.25
127 0.27
128 0.31
129 0.37
130 0.46
131 0.48
132 0.57
133 0.67
134 0.77
135 0.84
136 0.88
137 0.9
138 0.9
139 0.91
140 0.91
141 0.91
142 0.88
143 0.87
144 0.85
145 0.74
146 0.72
147 0.64
148 0.58
149 0.52
150 0.51
151 0.43
152 0.38
153 0.39
154 0.33
155 0.34
156 0.34
157 0.29
158 0.24
159 0.28
160 0.26
161 0.26
162 0.23
163 0.19
164 0.22
165 0.23