Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A017SMW3

Protein Details
Accession A0A017SMW3    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
23-44KFNSRMPHQNHRRQGRKVKGKTBasic
NLS Segment(s)
PositionSequence
32-47NHRRQGRKVKGKTAKI
Subcellular Location(s) nucl 14.5, mito_nucl 13.333, mito 10, cyto_nucl 9.166
Family & Domain DBs
Amino Acid Sequences MSWMFHYPSRARDRWHNEGNRQKFNSRMPHQNHRRQGRKVKGKTAKIWLKLSSDGGRLHRARTAMPSGKETLNLNRHAILLRVIWCHPKSREYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.69
3 0.68
4 0.69
5 0.76
6 0.79
7 0.78
8 0.74
9 0.67
10 0.62
11 0.62
12 0.62
13 0.57
14 0.59
15 0.57
16 0.64
17 0.71
18 0.75
19 0.77
20 0.77
21 0.79
22 0.78
23 0.81
24 0.81
25 0.81
26 0.77
27 0.78
28 0.77
29 0.75
30 0.71
31 0.71
32 0.66
33 0.6
34 0.58
35 0.5
36 0.43
37 0.38
38 0.37
39 0.29
40 0.25
41 0.23
42 0.23
43 0.28
44 0.26
45 0.26
46 0.26
47 0.24
48 0.22
49 0.24
50 0.29
51 0.28
52 0.29
53 0.31
54 0.31
55 0.31
56 0.32
57 0.31
58 0.31
59 0.32
60 0.33
61 0.31
62 0.29
63 0.3
64 0.29
65 0.27
66 0.21
67 0.18
68 0.18
69 0.19
70 0.2
71 0.27
72 0.28
73 0.35
74 0.36