Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E1S0P4

Protein Details
Accession A0A0E1S0P4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
261-280LSSRIPVKSQRGQRVPKEECHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR000791  Gpr1/Fun34/SatP  
Gene Ontology GO:0016020  C:membrane  
KEGG cim:CIMG_02166  -  
Pfam View protein in Pfam  
PF01184  Gpr1_Fun34_YaaH  
Amino Acid Sequences MPSTPVSTDKDDLNEINFEPIRRTQTAESVIIPRDVFEKLYLNPHQQPHADTLRKTFANPTPVALIGFLVATTPNACAAMGWSGAGRNSGAILSVLIFFGGFLQLLGGLGNWILGNTFSSTLFLTFGMFWLVQGTNLIPFFAVGSTYSPTGNPLEGQKTASFNATTGFFFVFLTLLTVFFLICSLRTNICLFLGLLFLVVAFACFAGTYFELALNHVASAERLQVVGGAFTFGLCVLVWYLLLAEMLETVDLPISLPIGDLSSRIPVKSQRGQRVPKEEC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.23
3 0.27
4 0.27
5 0.24
6 0.25
7 0.28
8 0.31
9 0.3
10 0.34
11 0.29
12 0.35
13 0.39
14 0.37
15 0.35
16 0.34
17 0.34
18 0.32
19 0.29
20 0.23
21 0.2
22 0.19
23 0.17
24 0.15
25 0.17
26 0.16
27 0.24
28 0.28
29 0.32
30 0.37
31 0.39
32 0.42
33 0.4
34 0.41
35 0.39
36 0.45
37 0.43
38 0.38
39 0.4
40 0.42
41 0.41
42 0.4
43 0.4
44 0.36
45 0.38
46 0.37
47 0.34
48 0.3
49 0.3
50 0.29
51 0.22
52 0.17
53 0.09
54 0.09
55 0.07
56 0.05
57 0.04
58 0.04
59 0.05
60 0.05
61 0.05
62 0.06
63 0.06
64 0.05
65 0.06
66 0.07
67 0.07
68 0.07
69 0.06
70 0.07
71 0.07
72 0.08
73 0.07
74 0.05
75 0.06
76 0.05
77 0.06
78 0.05
79 0.05
80 0.05
81 0.05
82 0.05
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.04
103 0.05
104 0.06
105 0.05
106 0.06
107 0.07
108 0.07
109 0.07
110 0.07
111 0.07
112 0.06
113 0.06
114 0.06
115 0.06
116 0.06
117 0.07
118 0.07
119 0.06
120 0.06
121 0.06
122 0.06
123 0.07
124 0.07
125 0.05
126 0.05
127 0.05
128 0.04
129 0.05
130 0.03
131 0.05
132 0.06
133 0.06
134 0.07
135 0.06
136 0.08
137 0.09
138 0.08
139 0.08
140 0.09
141 0.11
142 0.12
143 0.14
144 0.13
145 0.14
146 0.15
147 0.15
148 0.13
149 0.11
150 0.12
151 0.11
152 0.1
153 0.09
154 0.09
155 0.08
156 0.07
157 0.07
158 0.06
159 0.05
160 0.06
161 0.05
162 0.05
163 0.05
164 0.05
165 0.05
166 0.05
167 0.05
168 0.04
169 0.04
170 0.06
171 0.08
172 0.08
173 0.1
174 0.12
175 0.12
176 0.12
177 0.12
178 0.11
179 0.09
180 0.09
181 0.07
182 0.06
183 0.05
184 0.05
185 0.04
186 0.04
187 0.03
188 0.03
189 0.03
190 0.03
191 0.03
192 0.03
193 0.05
194 0.06
195 0.06
196 0.07
197 0.08
198 0.09
199 0.1
200 0.11
201 0.09
202 0.09
203 0.08
204 0.08
205 0.07
206 0.08
207 0.09
208 0.08
209 0.07
210 0.07
211 0.09
212 0.09
213 0.09
214 0.08
215 0.07
216 0.06
217 0.06
218 0.06
219 0.05
220 0.05
221 0.05
222 0.05
223 0.05
224 0.05
225 0.05
226 0.05
227 0.06
228 0.05
229 0.05
230 0.05
231 0.04
232 0.04
233 0.04
234 0.04
235 0.04
236 0.04
237 0.04
238 0.05
239 0.05
240 0.05
241 0.05
242 0.05
243 0.05
244 0.06
245 0.07
246 0.07
247 0.08
248 0.09
249 0.16
250 0.17
251 0.17
252 0.21
253 0.26
254 0.34
255 0.43
256 0.51
257 0.54
258 0.63
259 0.72
260 0.78