Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A017SAH1

Protein Details
Accession A0A017SAH1    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
27-60IKYIYQKQRYRRSIRPRKARCRLVRKRQVPELKQHydrophilic
NLS Segment(s)
PositionSequence
37-52RRSIRPRKARCRLVRK
Subcellular Location(s) cyto_nucl 11.833, mito 11.5, mito_nucl 11.164, nucl 8.5, cyto 7
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKIKIKGLPGLTQGYEYVLVLGILGTIKYIYQKQRYRRSIRPRKARCRLVRKRQVPELKQSEVAQASREAVKRVEGKCRAPYSKYIRLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.2
3 0.16
4 0.12
5 0.08
6 0.07
7 0.06
8 0.06
9 0.04
10 0.04
11 0.04
12 0.03
13 0.03
14 0.04
15 0.06
16 0.11
17 0.17
18 0.26
19 0.33
20 0.42
21 0.53
22 0.62
23 0.67
24 0.72
25 0.78
26 0.8
27 0.83
28 0.85
29 0.85
30 0.86
31 0.88
32 0.89
33 0.87
34 0.87
35 0.88
36 0.88
37 0.88
38 0.85
39 0.82
40 0.82
41 0.82
42 0.74
43 0.73
44 0.68
45 0.6
46 0.55
47 0.49
48 0.44
49 0.36
50 0.33
51 0.25
52 0.2
53 0.19
54 0.21
55 0.21
56 0.19
57 0.17
58 0.23
59 0.28
60 0.3
61 0.38
62 0.4
63 0.44
64 0.51
65 0.59
66 0.58
67 0.55
68 0.62
69 0.61