Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A017SDY5

Protein Details
Accession A0A017SDY5    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
80-111KRLCDGCKPVRRKNRVYIICSKNPKHKQRQGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16.5, mito_nucl 12.833, nucl 8, cyto_nucl 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MMSLRSLLGASTGTLRQYLPQSISRPTFFSRSFSRLSLANGLRSLRLRSEQKQTQVAGIGAVGARQIEQVRGMKTRSSVKRLCDGCKPVRRKNRVYIICSKNPKHKQRQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.14
4 0.17
5 0.2
6 0.21
7 0.25
8 0.27
9 0.32
10 0.36
11 0.34
12 0.34
13 0.34
14 0.36
15 0.31
16 0.33
17 0.33
18 0.33
19 0.34
20 0.31
21 0.3
22 0.25
23 0.27
24 0.3
25 0.26
26 0.24
27 0.23
28 0.23
29 0.23
30 0.23
31 0.22
32 0.15
33 0.2
34 0.23
35 0.25
36 0.33
37 0.36
38 0.38
39 0.41
40 0.4
41 0.35
42 0.31
43 0.27
44 0.18
45 0.13
46 0.1
47 0.06
48 0.05
49 0.04
50 0.03
51 0.03
52 0.04
53 0.05
54 0.05
55 0.08
56 0.11
57 0.13
58 0.16
59 0.17
60 0.17
61 0.21
62 0.3
63 0.33
64 0.38
65 0.4
66 0.41
67 0.48
68 0.51
69 0.51
70 0.5
71 0.52
72 0.54
73 0.6
74 0.65
75 0.66
76 0.73
77 0.78
78 0.77
79 0.79
80 0.8
81 0.79
82 0.78
83 0.78
84 0.76
85 0.77
86 0.79
87 0.75
88 0.75
89 0.77
90 0.81
91 0.82