Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A017S825

Protein Details
Accession A0A017S825    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
21-77PLFLCRRHTSRNQTRTKHRKLTPKIPRDKTPLTDRYRLRRQTKKQSKIQNRQQIQKTHydrophilic
NLS Segment(s)
PositionSequence
37-49KHRKLTPKIPRDK
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 3
Family & Domain DBs
Amino Acid Sequences MRADTHAVATANVNGKQPTPPLFLCRRHTSRNQTRTKHRKLTPKIPRDKTPLTDRYRLRRQTKKQSKIQNRQQIQKTMHITQNKQGNTDSRTNRPNKTTFPSSVNQPCTRMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.24
4 0.26
5 0.25
6 0.26
7 0.25
8 0.3
9 0.37
10 0.43
11 0.48
12 0.54
13 0.55
14 0.57
15 0.64
16 0.68
17 0.71
18 0.74
19 0.77
20 0.75
21 0.81
22 0.85
23 0.85
24 0.84
25 0.8
26 0.8
27 0.79
28 0.82
29 0.82
30 0.81
31 0.82
32 0.78
33 0.77
34 0.74
35 0.7
36 0.64
37 0.61
38 0.6
39 0.55
40 0.57
41 0.55
42 0.56
43 0.61
44 0.65
45 0.65
46 0.66
47 0.69
48 0.73
49 0.8
50 0.81
51 0.8
52 0.82
53 0.85
54 0.86
55 0.87
56 0.86
57 0.8
58 0.8
59 0.78
60 0.75
61 0.67
62 0.64
63 0.59
64 0.53
65 0.53
66 0.51
67 0.47
68 0.45
69 0.5
70 0.43
71 0.39
72 0.37
73 0.36
74 0.35
75 0.42
76 0.42
77 0.41
78 0.5
79 0.54
80 0.58
81 0.59
82 0.59
83 0.57
84 0.6
85 0.59
86 0.54
87 0.54
88 0.51
89 0.54
90 0.58
91 0.59
92 0.54