Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A017SDD0

Protein Details
Accession A0A017SDD0    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
22-42VPFSFWYRKHHCRKCGRVVCAHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 18, cyto 4, cyto_nucl 3.833, cyto_pero 3.333, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000306  Znf_FYVE  
IPR017455  Znf_FYVE-rel  
IPR011011  Znf_FYVE_PHD  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0016020  C:membrane  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF01363  FYVE  
PROSITE View protein in PROSITE  
PS50178  ZF_FYVE  
Amino Acid Sequences MEYVRPRWQPDDEVDECPICEVPFSFWYRKHHCRKCGRVVCASCSPHRITIPRQYIVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.33
3 0.29
4 0.26
5 0.22
6 0.13
7 0.11
8 0.08
9 0.09
10 0.13
11 0.17
12 0.19
13 0.22
14 0.3
15 0.38
16 0.47
17 0.55
18 0.58
19 0.64
20 0.72
21 0.76
22 0.8
23 0.81
24 0.76
25 0.74
26 0.7
27 0.66
28 0.64
29 0.59
30 0.51
31 0.47
32 0.45
33 0.4
34 0.41
35 0.41
36 0.39
37 0.46
38 0.51