Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A017S239

Protein Details
Accession A0A017S239   
Localization Confidence High
Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
378-414SVPQPQQQKKQEQPQKKRKKKKKQPEPKQPQGRPQSPHydrophilic
457-478KSTPSQSARRGRTPNKPKQPETHydrophilic
NLS Segment(s)
PositionSequence
390-414QPQKKRKKKKKQPEPKQPQGRPQSP
429-475RPPKSSPRPQKLKAISLPRLPSSPARSNKSTPSQSARRGRTPNKPKQ
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MPAEDYEWIANYWPQPSFSLGATNGYPDVQTRHVGQNSTPGYDGHMDRDPIALAQSALKSSVTYQPQNVYSYMSPHGSFFPPALMPAQPHQQHYQPALQQQHPPQCPQSAAPVGFRGHHPSTMSSQAPNLATSHPPPHTQPIFARPAPDLAPGPAPSAQQRPPAVSARRLPAPKPRAPLASSLNDDAKRRRVESGGQAKGISKHKLSGYSYQPSHPTRGTVLRDRNDIIRPLNKKDAAEKMAYDPKTVARDILVASGRHPTEPALNHHLSRLRDIFNLVDNTADLATIRWDIVDTPNMQVPHMHADPEPVSKHIPPPPVPIQSPAVNGWPPAQQACPASHSAALPRTPPAAPPRDQQQPITASPRPTPPSFPPAVSDSVPQPQQQKKQEQPQKKRKKKKKQPEPKQPQGRPQSPASVPKQSPVPLVQVRPPKSSPRPQKLKAISLPRLPSSPARSNKSTPSQSARRGRTPNKPKQPETMVGKKSAPKVEVSIPLSAPPVSYPVYACEWQNCQSELHNLELLRHHLLKSHIPYTITCSWSGCDCNDPMAAAELFNHVKSNHLDPLAWKLGDGPSVPQTGETDIML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.23
4 0.24
5 0.22
6 0.25
7 0.22
8 0.23
9 0.22
10 0.22
11 0.2
12 0.18
13 0.18
14 0.14
15 0.17
16 0.17
17 0.19
18 0.22
19 0.3
20 0.33
21 0.34
22 0.33
23 0.39
24 0.38
25 0.38
26 0.35
27 0.26
28 0.26
29 0.3
30 0.3
31 0.25
32 0.27
33 0.26
34 0.25
35 0.27
36 0.23
37 0.19
38 0.19
39 0.15
40 0.11
41 0.13
42 0.14
43 0.13
44 0.14
45 0.13
46 0.13
47 0.14
48 0.22
49 0.25
50 0.27
51 0.3
52 0.34
53 0.37
54 0.39
55 0.37
56 0.34
57 0.28
58 0.28
59 0.28
60 0.26
61 0.23
62 0.22
63 0.25
64 0.22
65 0.22
66 0.19
67 0.19
68 0.16
69 0.17
70 0.17
71 0.15
72 0.16
73 0.18
74 0.27
75 0.27
76 0.31
77 0.33
78 0.36
79 0.39
80 0.41
81 0.45
82 0.39
83 0.44
84 0.47
85 0.47
86 0.49
87 0.52
88 0.58
89 0.54
90 0.54
91 0.5
92 0.46
93 0.44
94 0.39
95 0.38
96 0.35
97 0.34
98 0.32
99 0.33
100 0.31
101 0.3
102 0.31
103 0.31
104 0.26
105 0.27
106 0.27
107 0.25
108 0.28
109 0.33
110 0.32
111 0.26
112 0.25
113 0.26
114 0.25
115 0.23
116 0.21
117 0.17
118 0.18
119 0.2
120 0.26
121 0.24
122 0.25
123 0.27
124 0.35
125 0.34
126 0.35
127 0.36
128 0.37
129 0.42
130 0.41
131 0.4
132 0.32
133 0.33
134 0.3
135 0.29
136 0.22
137 0.17
138 0.19
139 0.18
140 0.19
141 0.18
142 0.18
143 0.19
144 0.24
145 0.25
146 0.29
147 0.29
148 0.3
149 0.32
150 0.39
151 0.39
152 0.4
153 0.41
154 0.39
155 0.45
156 0.44
157 0.43
158 0.45
159 0.5
160 0.49
161 0.49
162 0.48
163 0.46
164 0.45
165 0.48
166 0.43
167 0.4
168 0.37
169 0.35
170 0.36
171 0.34
172 0.36
173 0.34
174 0.36
175 0.34
176 0.33
177 0.33
178 0.3
179 0.33
180 0.4
181 0.46
182 0.42
183 0.4
184 0.39
185 0.38
186 0.41
187 0.41
188 0.35
189 0.25
190 0.26
191 0.27
192 0.31
193 0.33
194 0.34
195 0.35
196 0.39
197 0.39
198 0.38
199 0.42
200 0.39
201 0.4
202 0.34
203 0.29
204 0.25
205 0.3
206 0.33
207 0.35
208 0.4
209 0.39
210 0.41
211 0.41
212 0.41
213 0.37
214 0.35
215 0.31
216 0.31
217 0.32
218 0.34
219 0.39
220 0.38
221 0.36
222 0.37
223 0.4
224 0.36
225 0.33
226 0.29
227 0.27
228 0.32
229 0.32
230 0.28
231 0.23
232 0.22
233 0.24
234 0.23
235 0.18
236 0.12
237 0.13
238 0.12
239 0.15
240 0.15
241 0.12
242 0.13
243 0.17
244 0.17
245 0.15
246 0.15
247 0.12
248 0.14
249 0.17
250 0.2
251 0.23
252 0.24
253 0.25
254 0.27
255 0.31
256 0.27
257 0.28
258 0.26
259 0.21
260 0.2
261 0.2
262 0.19
263 0.18
264 0.18
265 0.15
266 0.12
267 0.1
268 0.1
269 0.09
270 0.08
271 0.05
272 0.04
273 0.04
274 0.05
275 0.05
276 0.04
277 0.04
278 0.05
279 0.06
280 0.09
281 0.09
282 0.1
283 0.12
284 0.12
285 0.12
286 0.12
287 0.12
288 0.15
289 0.14
290 0.14
291 0.12
292 0.14
293 0.15
294 0.18
295 0.17
296 0.13
297 0.15
298 0.14
299 0.19
300 0.21
301 0.25
302 0.23
303 0.3
304 0.33
305 0.35
306 0.35
307 0.33
308 0.32
309 0.29
310 0.29
311 0.23
312 0.2
313 0.17
314 0.17
315 0.16
316 0.14
317 0.13
318 0.12
319 0.12
320 0.11
321 0.13
322 0.14
323 0.15
324 0.14
325 0.15
326 0.15
327 0.15
328 0.15
329 0.17
330 0.16
331 0.15
332 0.15
333 0.16
334 0.15
335 0.18
336 0.22
337 0.24
338 0.26
339 0.27
340 0.32
341 0.38
342 0.39
343 0.37
344 0.36
345 0.35
346 0.35
347 0.39
348 0.36
349 0.3
350 0.31
351 0.36
352 0.35
353 0.32
354 0.34
355 0.32
356 0.36
357 0.35
358 0.33
359 0.3
360 0.28
361 0.3
362 0.26
363 0.24
364 0.19
365 0.21
366 0.23
367 0.22
368 0.27
369 0.31
370 0.39
371 0.45
372 0.52
373 0.55
374 0.64
375 0.71
376 0.75
377 0.8
378 0.82
379 0.86
380 0.88
381 0.92
382 0.92
383 0.94
384 0.95
385 0.95
386 0.95
387 0.95
388 0.96
389 0.96
390 0.96
391 0.95
392 0.95
393 0.89
394 0.87
395 0.86
396 0.8
397 0.72
398 0.64
399 0.61
400 0.53
401 0.56
402 0.51
403 0.5
404 0.45
405 0.43
406 0.44
407 0.38
408 0.38
409 0.31
410 0.34
411 0.29
412 0.31
413 0.35
414 0.4
415 0.43
416 0.45
417 0.46
418 0.47
419 0.52
420 0.59
421 0.64
422 0.66
423 0.72
424 0.71
425 0.78
426 0.75
427 0.76
428 0.73
429 0.72
430 0.67
431 0.63
432 0.63
433 0.55
434 0.5
435 0.44
436 0.42
437 0.4
438 0.43
439 0.45
440 0.47
441 0.51
442 0.53
443 0.58
444 0.62
445 0.59
446 0.55
447 0.56
448 0.58
449 0.62
450 0.68
451 0.67
452 0.67
453 0.71
454 0.73
455 0.76
456 0.79
457 0.8
458 0.82
459 0.84
460 0.79
461 0.78
462 0.77
463 0.75
464 0.72
465 0.71
466 0.64
467 0.58
468 0.59
469 0.56
470 0.56
471 0.52
472 0.45
473 0.37
474 0.38
475 0.39
476 0.43
477 0.4
478 0.36
479 0.31
480 0.31
481 0.3
482 0.27
483 0.21
484 0.14
485 0.15
486 0.13
487 0.14
488 0.13
489 0.15
490 0.2
491 0.21
492 0.22
493 0.24
494 0.26
495 0.3
496 0.33
497 0.31
498 0.28
499 0.29
500 0.35
501 0.32
502 0.32
503 0.3
504 0.26
505 0.28
506 0.3
507 0.31
508 0.29
509 0.28
510 0.25
511 0.26
512 0.3
513 0.35
514 0.37
515 0.38
516 0.35
517 0.35
518 0.36
519 0.39
520 0.43
521 0.36
522 0.31
523 0.29
524 0.27
525 0.29
526 0.31
527 0.25
528 0.23
529 0.22
530 0.23
531 0.23
532 0.22
533 0.19
534 0.2
535 0.19
536 0.14
537 0.14
538 0.17
539 0.18
540 0.18
541 0.19
542 0.15
543 0.2
544 0.23
545 0.27
546 0.28
547 0.28
548 0.29
549 0.28
550 0.37
551 0.39
552 0.35
553 0.3
554 0.27
555 0.27
556 0.29
557 0.28
558 0.24
559 0.22
560 0.24
561 0.24
562 0.22
563 0.22
564 0.21