Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3K6W8

Protein Details
Accession J3K6W8    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
86-113LVLEKQKEEEKKEKKREKKNNNDNEDDDAcidic
NLS Segment(s)
PositionSequence
94-104EEKKEKKREKK
Subcellular Location(s) cyto 16.5, cyto_nucl 10.5, mito 6, nucl 3.5
Family & Domain DBs
KEGG cim:CIMG_12995  -  
Amino Acid Sequences MVHCKHITVNANDMKLVLGISAKIRSNYFSLIDVPDHPAPAATTCCLCAASTLPTTAAISLPSLGAVRISACQMVGIRASVQFTKLVLEKQKEEEKKEKKREKKNNNDNEDDDDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.23
3 0.2
4 0.11
5 0.07
6 0.07
7 0.09
8 0.13
9 0.14
10 0.16
11 0.16
12 0.18
13 0.19
14 0.2
15 0.2
16 0.17
17 0.17
18 0.17
19 0.18
20 0.17
21 0.2
22 0.18
23 0.17
24 0.15
25 0.14
26 0.13
27 0.13
28 0.13
29 0.09
30 0.08
31 0.09
32 0.09
33 0.1
34 0.09
35 0.08
36 0.08
37 0.1
38 0.1
39 0.1
40 0.1
41 0.1
42 0.1
43 0.09
44 0.08
45 0.06
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.04
52 0.04
53 0.04
54 0.04
55 0.05
56 0.05
57 0.05
58 0.05
59 0.06
60 0.06
61 0.07
62 0.07
63 0.07
64 0.07
65 0.07
66 0.09
67 0.09
68 0.1
69 0.09
70 0.09
71 0.11
72 0.12
73 0.16
74 0.21
75 0.24
76 0.26
77 0.32
78 0.41
79 0.44
80 0.49
81 0.55
82 0.59
83 0.66
84 0.75
85 0.79
86 0.8
87 0.87
88 0.91
89 0.92
90 0.93
91 0.93
92 0.93
93 0.91
94 0.88
95 0.8
96 0.76