Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A017SKQ2

Protein Details
Accession A0A017SKQ2    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MTNIRQAKKNRSSLPKAKPKRSGVVKSGRKKINHydrophilic
NLS Segment(s)
PositionSequence
7-31AKKNRSSLPKAKPKRSGVVKSGRKK
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019002  Ribosome_biogenesis_Nop16  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF09420  Nop16  
Amino Acid Sequences MTNIRQAKKNRSSLPKAKPKRSGVVKSGRKKINVLGNSIIAENWDRKQTLTQNYRRLGLVHRLNAPAGGSERRGTTVEGYEEQPDDSLHIKSSAKATTKQLGLGEIRVERDPETGNIIRVIRPDDEIEVAGRKHKISNPLNDPLNDLSNDESRITEAAKQNDSSVIVQMLERQAVQEGKAVESKKPRHLSKREEEWATRLIERHGDDYSAMARDMKLNPMQQTVGDLKRRIRKFKESQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.87
4 0.87
5 0.87
6 0.84
7 0.84
8 0.84
9 0.81
10 0.79
11 0.8
12 0.8
13 0.8
14 0.83
15 0.79
16 0.72
17 0.66
18 0.63
19 0.62
20 0.55
21 0.51
22 0.44
23 0.39
24 0.38
25 0.35
26 0.28
27 0.19
28 0.19
29 0.17
30 0.16
31 0.17
32 0.17
33 0.18
34 0.24
35 0.3
36 0.38
37 0.45
38 0.51
39 0.57
40 0.59
41 0.6
42 0.54
43 0.49
44 0.43
45 0.42
46 0.41
47 0.36
48 0.37
49 0.36
50 0.36
51 0.34
52 0.3
53 0.22
54 0.18
55 0.16
56 0.14
57 0.14
58 0.14
59 0.16
60 0.16
61 0.16
62 0.15
63 0.16
64 0.16
65 0.17
66 0.18
67 0.17
68 0.17
69 0.16
70 0.14
71 0.11
72 0.11
73 0.11
74 0.1
75 0.09
76 0.11
77 0.11
78 0.12
79 0.15
80 0.18
81 0.19
82 0.22
83 0.25
84 0.27
85 0.27
86 0.28
87 0.25
88 0.23
89 0.21
90 0.18
91 0.17
92 0.13
93 0.14
94 0.12
95 0.13
96 0.11
97 0.12
98 0.12
99 0.1
100 0.15
101 0.14
102 0.14
103 0.16
104 0.16
105 0.15
106 0.15
107 0.16
108 0.11
109 0.12
110 0.12
111 0.1
112 0.1
113 0.1
114 0.1
115 0.1
116 0.09
117 0.11
118 0.11
119 0.11
120 0.13
121 0.15
122 0.25
123 0.28
124 0.36
125 0.39
126 0.44
127 0.46
128 0.43
129 0.43
130 0.35
131 0.31
132 0.24
133 0.19
134 0.15
135 0.14
136 0.15
137 0.13
138 0.12
139 0.11
140 0.11
141 0.11
142 0.15
143 0.18
144 0.21
145 0.22
146 0.22
147 0.22
148 0.23
149 0.24
150 0.19
151 0.15
152 0.12
153 0.1
154 0.1
155 0.12
156 0.11
157 0.1
158 0.09
159 0.09
160 0.11
161 0.11
162 0.12
163 0.13
164 0.12
165 0.14
166 0.18
167 0.19
168 0.21
169 0.3
170 0.35
171 0.41
172 0.49
173 0.55
174 0.61
175 0.69
176 0.74
177 0.75
178 0.79
179 0.77
180 0.74
181 0.68
182 0.62
183 0.57
184 0.51
185 0.43
186 0.34
187 0.28
188 0.28
189 0.28
190 0.27
191 0.23
192 0.21
193 0.19
194 0.2
195 0.2
196 0.16
197 0.14
198 0.13
199 0.12
200 0.16
201 0.18
202 0.22
203 0.25
204 0.28
205 0.3
206 0.32
207 0.32
208 0.28
209 0.32
210 0.32
211 0.35
212 0.37
213 0.39
214 0.43
215 0.53
216 0.6
217 0.65
218 0.66
219 0.69