Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A017SEB1

Protein Details
Accession A0A017SEB1   
Localization Confidence High
Confidence Score 21.2
NoLS Segment(s)
PositionSequenceProtein Nature
481-501GTENTPRRRGRPRKTDKADGTBasic
632-657PEGQTEGPPQKRRRGRPRKVDTIAAGHydrophilic
659-693AAAAPRPKPKKPAGPPKPSKTGRPRGRPRKVDVAABasic
NLS Segment(s)
PositionSequence
486-513PRRRGRPRKTDKADGTAPAKPKPKAKSK
640-688PQKRRRGRPRKVDTIAAGGAAAAPRPKPKKPAGPPKPSKTGRPRGRPRK
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MMGYGGHPFQAPPPQQQHPRHTSHQQHPPNHSLQSPSMSAAGHPAHTHPRHANGSIPGTANPLFRGQPQPTTTDLTHSSDLRKMTAPVTSAPLVGLSAGGNFSPFPGNFPQGSSELLSRNTDSVGGVKDPYLSMQTLQRNINPMASFRPHHPTAMNPQAALSPHAHAMNLSSSSQSPQQSSLERLQQHHRQGSHPATSASPMLAPSPRPQQPPLPPPQSQSQSQAQSQRPAHHSPYQTQRPQAQYTSQAQHYPSAQQAQYPQQPQYPQQLQYSSQPQPQQQPQTQQTSYQPTQRPHFSPQQAYQSQPQARHYQQPQQPLPQSQQPQQPQQPQQSQYQPPQNPYAPNPYQQFSFQPHQYHHPQSQQHALLQQHHHHHQQQQQPPPPPPPPPQQQPQQPQPRPAATTAAPATAPMSMPSTIGVAEILTTATKQEQDEEEKLAPPNKRSKPAPKQSQPSAPAPAPVLQQLNGPTKSESASGAAGTENTPRRRGRPRKTDKADGTAPAKPKPKAKSKSASSTPNTVPASVPYQHPHPAPSPHAQAAPPPSAHPQFAPPMPQIQQHQHQFHYTMHAHPQPPQQQPQPPSIPQAQPQHLQQQPAQSPQARPVQIQVPVPSPAAQPQAQPQQQQTHQSPEGQTEGPPQKRRRGRPRKVDTIAAGGAAAAPRPKPKKPAGPPKPSKTGRPRGRPRKVDVAAQQQQQAQQAQQQQQSGTGMEQGNQAPAPAPTQAPPPPNPMAMHMNTLNMGIGMNPVHKRDILHSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.58
3 0.66
4 0.72
5 0.71
6 0.75
7 0.74
8 0.77
9 0.78
10 0.78
11 0.8
12 0.79
13 0.79
14 0.8
15 0.79
16 0.74
17 0.67
18 0.6
19 0.54
20 0.48
21 0.45
22 0.39
23 0.33
24 0.29
25 0.26
26 0.23
27 0.25
28 0.23
29 0.19
30 0.19
31 0.21
32 0.3
33 0.32
34 0.38
35 0.36
36 0.42
37 0.46
38 0.46
39 0.48
40 0.44
41 0.46
42 0.43
43 0.4
44 0.33
45 0.32
46 0.33
47 0.29
48 0.24
49 0.23
50 0.21
51 0.24
52 0.31
53 0.3
54 0.36
55 0.36
56 0.38
57 0.38
58 0.42
59 0.38
60 0.35
61 0.36
62 0.33
63 0.34
64 0.33
65 0.33
66 0.32
67 0.33
68 0.3
69 0.29
70 0.26
71 0.24
72 0.25
73 0.24
74 0.21
75 0.25
76 0.23
77 0.21
78 0.19
79 0.18
80 0.15
81 0.13
82 0.11
83 0.06
84 0.06
85 0.06
86 0.06
87 0.06
88 0.06
89 0.07
90 0.11
91 0.11
92 0.14
93 0.18
94 0.22
95 0.22
96 0.24
97 0.26
98 0.22
99 0.24
100 0.22
101 0.21
102 0.2
103 0.22
104 0.23
105 0.21
106 0.2
107 0.19
108 0.17
109 0.15
110 0.15
111 0.15
112 0.14
113 0.14
114 0.13
115 0.14
116 0.14
117 0.14
118 0.14
119 0.12
120 0.13
121 0.19
122 0.24
123 0.28
124 0.31
125 0.32
126 0.34
127 0.35
128 0.38
129 0.32
130 0.28
131 0.28
132 0.3
133 0.3
134 0.29
135 0.36
136 0.32
137 0.33
138 0.33
139 0.32
140 0.36
141 0.44
142 0.41
143 0.33
144 0.33
145 0.33
146 0.33
147 0.3
148 0.23
149 0.15
150 0.16
151 0.17
152 0.16
153 0.13
154 0.14
155 0.15
156 0.15
157 0.14
158 0.13
159 0.13
160 0.15
161 0.2
162 0.2
163 0.19
164 0.2
165 0.23
166 0.24
167 0.28
168 0.31
169 0.33
170 0.35
171 0.37
172 0.43
173 0.47
174 0.52
175 0.54
176 0.5
177 0.46
178 0.5
179 0.52
180 0.49
181 0.43
182 0.36
183 0.31
184 0.3
185 0.28
186 0.2
187 0.16
188 0.11
189 0.12
190 0.13
191 0.14
192 0.16
193 0.24
194 0.28
195 0.31
196 0.34
197 0.4
198 0.47
199 0.53
200 0.58
201 0.57
202 0.53
203 0.53
204 0.58
205 0.54
206 0.48
207 0.45
208 0.43
209 0.4
210 0.43
211 0.48
212 0.43
213 0.47
214 0.48
215 0.49
216 0.47
217 0.48
218 0.49
219 0.47
220 0.47
221 0.45
222 0.52
223 0.55
224 0.54
225 0.54
226 0.55
227 0.53
228 0.53
229 0.49
230 0.42
231 0.39
232 0.41
233 0.41
234 0.37
235 0.35
236 0.32
237 0.32
238 0.3
239 0.26
240 0.23
241 0.23
242 0.21
243 0.2
244 0.23
245 0.27
246 0.32
247 0.33
248 0.32
249 0.3
250 0.32
251 0.34
252 0.39
253 0.38
254 0.35
255 0.35
256 0.36
257 0.34
258 0.37
259 0.41
260 0.35
261 0.34
262 0.35
263 0.35
264 0.4
265 0.44
266 0.47
267 0.44
268 0.49
269 0.5
270 0.53
271 0.51
272 0.47
273 0.45
274 0.45
275 0.44
276 0.43
277 0.44
278 0.4
279 0.45
280 0.47
281 0.46
282 0.43
283 0.5
284 0.47
285 0.47
286 0.47
287 0.51
288 0.48
289 0.47
290 0.45
291 0.44
292 0.43
293 0.4
294 0.39
295 0.37
296 0.37
297 0.43
298 0.42
299 0.43
300 0.44
301 0.5
302 0.5
303 0.49
304 0.51
305 0.45
306 0.45
307 0.42
308 0.42
309 0.39
310 0.44
311 0.41
312 0.45
313 0.49
314 0.54
315 0.53
316 0.57
317 0.58
318 0.53
319 0.54
320 0.55
321 0.53
322 0.51
323 0.54
324 0.48
325 0.45
326 0.47
327 0.44
328 0.38
329 0.36
330 0.39
331 0.32
332 0.35
333 0.34
334 0.3
335 0.29
336 0.28
337 0.28
338 0.24
339 0.27
340 0.26
341 0.26
342 0.27
343 0.31
344 0.36
345 0.38
346 0.36
347 0.39
348 0.37
349 0.37
350 0.42
351 0.37
352 0.32
353 0.32
354 0.3
355 0.28
356 0.29
357 0.31
358 0.29
359 0.31
360 0.34
361 0.33
362 0.37
363 0.39
364 0.44
365 0.47
366 0.51
367 0.54
368 0.55
369 0.54
370 0.53
371 0.5
372 0.47
373 0.45
374 0.44
375 0.45
376 0.46
377 0.49
378 0.51
379 0.57
380 0.58
381 0.63
382 0.66
383 0.62
384 0.61
385 0.6
386 0.54
387 0.47
388 0.41
389 0.35
390 0.24
391 0.26
392 0.21
393 0.18
394 0.15
395 0.14
396 0.13
397 0.1
398 0.1
399 0.06
400 0.07
401 0.07
402 0.07
403 0.07
404 0.07
405 0.07
406 0.07
407 0.06
408 0.04
409 0.04
410 0.04
411 0.04
412 0.03
413 0.03
414 0.04
415 0.05
416 0.06
417 0.06
418 0.08
419 0.1
420 0.15
421 0.17
422 0.19
423 0.2
424 0.2
425 0.22
426 0.25
427 0.25
428 0.24
429 0.33
430 0.35
431 0.4
432 0.44
433 0.53
434 0.59
435 0.67
436 0.74
437 0.72
438 0.74
439 0.73
440 0.76
441 0.69
442 0.62
443 0.56
444 0.45
445 0.38
446 0.33
447 0.29
448 0.22
449 0.2
450 0.18
451 0.13
452 0.15
453 0.18
454 0.23
455 0.21
456 0.22
457 0.2
458 0.2
459 0.2
460 0.19
461 0.15
462 0.11
463 0.11
464 0.09
465 0.09
466 0.09
467 0.08
468 0.08
469 0.13
470 0.18
471 0.19
472 0.25
473 0.26
474 0.32
475 0.43
476 0.53
477 0.58
478 0.63
479 0.72
480 0.77
481 0.83
482 0.87
483 0.8
484 0.76
485 0.69
486 0.62
487 0.55
488 0.49
489 0.44
490 0.4
491 0.42
492 0.38
493 0.42
494 0.45
495 0.52
496 0.54
497 0.6
498 0.64
499 0.65
500 0.71
501 0.71
502 0.72
503 0.65
504 0.65
505 0.57
506 0.55
507 0.49
508 0.4
509 0.33
510 0.27
511 0.28
512 0.23
513 0.25
514 0.19
515 0.22
516 0.25
517 0.25
518 0.26
519 0.26
520 0.28
521 0.31
522 0.34
523 0.35
524 0.33
525 0.34
526 0.32
527 0.31
528 0.32
529 0.3
530 0.26
531 0.23
532 0.27
533 0.27
534 0.27
535 0.24
536 0.23
537 0.24
538 0.25
539 0.27
540 0.22
541 0.25
542 0.26
543 0.29
544 0.29
545 0.32
546 0.39
547 0.43
548 0.45
549 0.42
550 0.43
551 0.41
552 0.38
553 0.39
554 0.33
555 0.28
556 0.31
557 0.35
558 0.34
559 0.37
560 0.44
561 0.45
562 0.5
563 0.54
564 0.54
565 0.56
566 0.57
567 0.6
568 0.58
569 0.51
570 0.5
571 0.5
572 0.46
573 0.46
574 0.51
575 0.47
576 0.44
577 0.46
578 0.5
579 0.46
580 0.46
581 0.41
582 0.42
583 0.41
584 0.42
585 0.45
586 0.4
587 0.39
588 0.42
589 0.48
590 0.4
591 0.37
592 0.36
593 0.36
594 0.36
595 0.38
596 0.34
597 0.29
598 0.29
599 0.3
600 0.27
601 0.23
602 0.23
603 0.24
604 0.22
605 0.21
606 0.27
607 0.36
608 0.38
609 0.4
610 0.41
611 0.45
612 0.48
613 0.54
614 0.5
615 0.49
616 0.47
617 0.48
618 0.45
619 0.39
620 0.39
621 0.32
622 0.29
623 0.3
624 0.37
625 0.41
626 0.49
627 0.52
628 0.58
629 0.67
630 0.77
631 0.79
632 0.82
633 0.84
634 0.86
635 0.91
636 0.91
637 0.87
638 0.82
639 0.73
640 0.68
641 0.57
642 0.46
643 0.36
644 0.25
645 0.21
646 0.14
647 0.13
648 0.09
649 0.1
650 0.19
651 0.25
652 0.3
653 0.37
654 0.46
655 0.55
656 0.64
657 0.74
658 0.76
659 0.82
660 0.88
661 0.88
662 0.9
663 0.83
664 0.82
665 0.82
666 0.82
667 0.81
668 0.82
669 0.85
670 0.86
671 0.93
672 0.91
673 0.87
674 0.87
675 0.8
676 0.77
677 0.74
678 0.74
679 0.71
680 0.66
681 0.63
682 0.55
683 0.54
684 0.5
685 0.45
686 0.35
687 0.34
688 0.39
689 0.42
690 0.43
691 0.43
692 0.39
693 0.39
694 0.39
695 0.33
696 0.26
697 0.25
698 0.21
699 0.19
700 0.23
701 0.21
702 0.22
703 0.21
704 0.21
705 0.16
706 0.16
707 0.16
708 0.14
709 0.15
710 0.14
711 0.21
712 0.27
713 0.32
714 0.34
715 0.39
716 0.4
717 0.43
718 0.42
719 0.41
720 0.42
721 0.38
722 0.41
723 0.35
724 0.33
725 0.3
726 0.29
727 0.24
728 0.16
729 0.14
730 0.08
731 0.09
732 0.09
733 0.15
734 0.17
735 0.19
736 0.22
737 0.23
738 0.25