FuNGI

A0A017SEB1

Protein Details

Accession

A0A017SEB1

Localization Confidence

High

Confidence Score

21.2

NoLS Segment(s)

Position	Sequence	Protein Nature
481-501	GTENTPRRRGRPRKTDKADGT	Basic
632-657	PEGQTEGPPQKRRRGRPRKVDTIAAG	Hydrophilic
659-693	AAAAPRPKPKKPAGPPKPSKTGRPRGRPRKVDVAA	Basic

NLS Segment(s)

Position	Sequence
486-513	PRRRGRPRKTDKADGTAPAKPKPKAKSK
640-688	PQKRRRGRPRKVDTIAAGGAAAAPRPKPKKPAGPPKPSKTGRPRGRPRK

Subcellular Location(s)

nucl 24.5, cyto_nucl 15

Family & Domain DBs

InterPro	View protein in InterPro IPR017956 AT_hook_DNA-bd_motif
Gene Ontology	GO:0003677 F:DNA binding
Pfam	View protein in Pfam PF02178 AT_hook

Amino Acid Sequences

MMGYGGHPFQAPPPQQQHPRHTSHQQHPPNHSLQSPSMSAAGHPAHTHPRHANGSIPGTANPLFRGQPQPTTTDLTHSSDLRKMTAPVTSAPLVGLSAGGNFSPFPGNFPQGSSELLSRNTDSVGGVKDPYLSMQTLQRNINPMASFRPHHPTAMNPQAALSPHAHAMNLSSSSQSPQQSSLERLQQHHRQGSHPATSASPMLAPSPRPQQPPLPPPQSQSQSQAQSQRPAHHSPYQTQRPQAQYTSQAQHYPSAQQAQYPQQPQYPQQLQYSSQPQPQQQPQTQQTSYQPTQRPHFSPQQAYQSQPQARHYQQPQQPLPQSQQPQQPQQPQQSQYQPPQNPYAPNPYQQFSFQPHQYHHPQSQQHALLQQHHHHHQQQQQPPPPPPPPPQQQPQQPQPRPAATTAAPATAPMSMPSTIGVAEILTTATKQEQDEEEKLAPPNKRSKPAPKQSQPSAPAPAPVLQQLNGPTKSESASGAAGTENTPRRRGRPRKTDKADGTAPAKPKPKAKSKSASSTPNTVPASVPYQHPHPAPSPHAQAAPPPSAHPQFAPPMPQIQQHQHQFHYTMHAHPQPPQQQPQPPSIPQAQPQHLQQQPAQSPQARPVQIQVPVPSPAAQPQAQPQQQQTHQSPEGQTEGPPQKRRRGRPRKVDTIAAGGAAAAPRPKPKKPAGPPKPSKTGRPRGRPRKVDVAAQQQQQAQQAQQQQQSGTGMEQGNQAPAPAPTQAPPPPNPMAMHMNTLNMGIGMNPVHKRDILHSI

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.48
2	0.58
3	0.66
4	0.72
5	0.71
6	0.75
7	0.74
8	0.77
9	0.78
10	0.78
11	0.8
12	0.79
13	0.79
14	0.8
15	0.79
16	0.74
17	0.67
18	0.6
19	0.54
20	0.48
21	0.45
22	0.39
23	0.33
24	0.29
25	0.26
26	0.23
27	0.25
28	0.23
29	0.19
30	0.19
31	0.21
32	0.3
33	0.32
34	0.38
35	0.36
36	0.42
37	0.46
38	0.46
39	0.48
40	0.44
41	0.46
42	0.43
43	0.4
44	0.33
45	0.32
46	0.33
47	0.29
48	0.24
49	0.23
50	0.21
51	0.24
52	0.31
53	0.3
54	0.36
55	0.36
56	0.38
57	0.38
58	0.42
59	0.38
60	0.35
61	0.36
62	0.33
63	0.34
64	0.33
65	0.33
66	0.32
67	0.33
68	0.3
69	0.29
70	0.26
71	0.24
72	0.25
73	0.24
74	0.21
75	0.25
76	0.23
77	0.21
78	0.19
79	0.18
80	0.15
81	0.13
82	0.11
83	0.06
84	0.06
85	0.06
86	0.06
87	0.06
88	0.06
89	0.07
90	0.11
91	0.11
92	0.14
93	0.18
94	0.22
95	0.22
96	0.24
97	0.26
98	0.22
99	0.24
100	0.22
101	0.21
102	0.2
103	0.22
104	0.23
105	0.21
106	0.2
107	0.19
108	0.17
109	0.15
110	0.15
111	0.15
112	0.14
113	0.14
114	0.13
115	0.14
116	0.14
117	0.14
118	0.14
119	0.12
120	0.13
121	0.19
122	0.24
123	0.28
124	0.31
125	0.32
126	0.34
127	0.35
128	0.38
129	0.32
130	0.28
131	0.28
132	0.3
133	0.3
134	0.29
135	0.36
136	0.32
137	0.33
138	0.33
139	0.32
140	0.36
141	0.44
142	0.41
143	0.33
144	0.33
145	0.33
146	0.33
147	0.3
148	0.23
149	0.15
150	0.16
151	0.17
152	0.16
153	0.13
154	0.14
155	0.15
156	0.15
157	0.14
158	0.13
159	0.13
160	0.15
161	0.2
162	0.2
163	0.19
164	0.2
165	0.23
166	0.24
167	0.28
168	0.31
169	0.33
170	0.35
171	0.37
172	0.43
173	0.47
174	0.52
175	0.54
176	0.5
177	0.46
178	0.5
179	0.52
180	0.49
181	0.43
182	0.36
183	0.31
184	0.3
185	0.28
186	0.2
187	0.16
188	0.11
189	0.12
190	0.13
191	0.14
192	0.16
193	0.24
194	0.28
195	0.31
196	0.34
197	0.4
198	0.47
199	0.53
200	0.58
201	0.57
202	0.53
203	0.53
204	0.58
205	0.54
206	0.48
207	0.45
208	0.43
209	0.4
210	0.43
211	0.48
212	0.43
213	0.47
214	0.48
215	0.49
216	0.47
217	0.48
218	0.49
219	0.47
220	0.47
221	0.45
222	0.52
223	0.55
224	0.54
225	0.54
226	0.55
227	0.53
228	0.53
229	0.49
230	0.42
231	0.39
232	0.41
233	0.41
234	0.37
235	0.35
236	0.32
237	0.32
238	0.3
239	0.26
240	0.23
241	0.23
242	0.21
243	0.2
244	0.23
245	0.27
246	0.32
247	0.33
248	0.32
249	0.3
250	0.32
251	0.34
252	0.39
253	0.38
254	0.35
255	0.35
256	0.36
257	0.34
258	0.37
259	0.41
260	0.35
261	0.34
262	0.35
263	0.35
264	0.4
265	0.44
266	0.47
267	0.44
268	0.49
269	0.5
270	0.53
271	0.51
272	0.47
273	0.45
274	0.45
275	0.44
276	0.43
277	0.44
278	0.4
279	0.45
280	0.47
281	0.46
282	0.43
283	0.5
284	0.47
285	0.47
286	0.47
287	0.51
288	0.48
289	0.47
290	0.45
291	0.44
292	0.43
293	0.4
294	0.39
295	0.37
296	0.37
297	0.43
298	0.42
299	0.43
300	0.44
301	0.5
302	0.5
303	0.49
304	0.51
305	0.45
306	0.45
307	0.42
308	0.42
309	0.39
310	0.44
311	0.41
312	0.45
313	0.49
314	0.54
315	0.53
316	0.57
317	0.58
318	0.53
319	0.54
320	0.55
321	0.53
322	0.51
323	0.54
324	0.48
325	0.45
326	0.47
327	0.44
328	0.38
329	0.36
330	0.39
331	0.32
332	0.35
333	0.34
334	0.3
335	0.29
336	0.28
337	0.28
338	0.24
339	0.27
340	0.26
341	0.26
342	0.27
343	0.31
344	0.36
345	0.38
346	0.36
347	0.39
348	0.37
349	0.37
350	0.42
351	0.37
352	0.32
353	0.32
354	0.3
355	0.28
356	0.29
357	0.31
358	0.29
359	0.31
360	0.34
361	0.33
362	0.37
363	0.39
364	0.44
365	0.47
366	0.51
367	0.54
368	0.55
369	0.54
370	0.53
371	0.5
372	0.47
373	0.45
374	0.44
375	0.45
376	0.46
377	0.49
378	0.51
379	0.57
380	0.58
381	0.63
382	0.66
383	0.62
384	0.61
385	0.6
386	0.54
387	0.47
388	0.41
389	0.35
390	0.24
391	0.26
392	0.21
393	0.18
394	0.15
395	0.14
396	0.13
397	0.1
398	0.1
399	0.06
400	0.07
401	0.07
402	0.07
403	0.07
404	0.07
405	0.07
406	0.07
407	0.06
408	0.04
409	0.04
410	0.04
411	0.04
412	0.03
413	0.03
414	0.04
415	0.05
416	0.06
417	0.06
418	0.08
419	0.1
420	0.15
421	0.17
422	0.19
423	0.2
424	0.2
425	0.22
426	0.25
427	0.25
428	0.24
429	0.33
430	0.35
431	0.4
432	0.44
433	0.53
434	0.59
435	0.67
436	0.74
437	0.72
438	0.74
439	0.73
440	0.76
441	0.69
442	0.62
443	0.56
444	0.45
445	0.38
446	0.33
447	0.29
448	0.22
449	0.2
450	0.18
451	0.13
452	0.15
453	0.18
454	0.23
455	0.21
456	0.22
457	0.2
458	0.2
459	0.2
460	0.19
461	0.15
462	0.11
463	0.11
464	0.09
465	0.09
466	0.09
467	0.08
468	0.08
469	0.13
470	0.18
471	0.19
472	0.25
473	0.26
474	0.32
475	0.43
476	0.53
477	0.58
478	0.63
479	0.72
480	0.77
481	0.83
482	0.87
483	0.8
484	0.76
485	0.69
486	0.62
487	0.55
488	0.49
489	0.44
490	0.4
491	0.42
492	0.38
493	0.42
494	0.45
495	0.52
496	0.54
497	0.6
498	0.64
499	0.65
500	0.71
501	0.71
502	0.72
503	0.65
504	0.65
505	0.57
506	0.55
507	0.49
508	0.4
509	0.33
510	0.27
511	0.28
512	0.23
513	0.25
514	0.19
515	0.22
516	0.25
517	0.25
518	0.26
519	0.26
520	0.28
521	0.31
522	0.34
523	0.35
524	0.33
525	0.34
526	0.32
527	0.31
528	0.32
529	0.3
530	0.26
531	0.23
532	0.27
533	0.27
534	0.27
535	0.24
536	0.23
537	0.24
538	0.25
539	0.27
540	0.22
541	0.25
542	0.26
543	0.29
544	0.29
545	0.32
546	0.39
547	0.43
548	0.45
549	0.42
550	0.43
551	0.41
552	0.38
553	0.39
554	0.33
555	0.28
556	0.31
557	0.35
558	0.34
559	0.37
560	0.44
561	0.45
562	0.5
563	0.54
564	0.54
565	0.56
566	0.57
567	0.6
568	0.58
569	0.51
570	0.5
571	0.5
572	0.46
573	0.46
574	0.51
575	0.47
576	0.44
577	0.46
578	0.5
579	0.46
580	0.46
581	0.41
582	0.42
583	0.41
584	0.42
585	0.45
586	0.4
587	0.39
588	0.42
589	0.48
590	0.4
591	0.37
592	0.36
593	0.36
594	0.36
595	0.38
596	0.34
597	0.29
598	0.29
599	0.3
600	0.27
601	0.23
602	0.23
603	0.24
604	0.22
605	0.21
606	0.27
607	0.36
608	0.38
609	0.4
610	0.41
611	0.45
612	0.48
613	0.54
614	0.5
615	0.49
616	0.47
617	0.48
618	0.45
619	0.39
620	0.39
621	0.32
622	0.29
623	0.3
624	0.37
625	0.41
626	0.49
627	0.52
628	0.58
629	0.67
630	0.77
631	0.79
632	0.82
633	0.84
634	0.86
635	0.91
636	0.91
637	0.87
638	0.82
639	0.73
640	0.68
641	0.57
642	0.46
643	0.36
644	0.25
645	0.21
646	0.14
647	0.13
648	0.09
649	0.1
650	0.19
651	0.25
652	0.3
653	0.37
654	0.46
655	0.55
656	0.64
657	0.74
658	0.76
659	0.82
660	0.88
661	0.88
662	0.9
663	0.83
664	0.82
665	0.82
666	0.82
667	0.81
668	0.82
669	0.85
670	0.86
671	0.93
672	0.91
673	0.87
674	0.87
675	0.8
676	0.77
677	0.74
678	0.74
679	0.71
680	0.66
681	0.63
682	0.55
683	0.54
684	0.5
685	0.45
686	0.35
687	0.34
688	0.39
689	0.42
690	0.43
691	0.43
692	0.39
693	0.39
694	0.39
695	0.33
696	0.26
697	0.25
698	0.21
699	0.19
700	0.23
701	0.21
702	0.22
703	0.21
704	0.21
705	0.16
706	0.16
707	0.16
708	0.14
709	0.15
710	0.14
711	0.21
712	0.27
713	0.32
714	0.34
715	0.39
716	0.4
717	0.43
718	0.42
719	0.41
720	0.42
721	0.38
722	0.41
723	0.35
724	0.33
725	0.3
726	0.29
727	0.24
728	0.16
729	0.14
730	0.08
731	0.09
732	0.09
733	0.15
734	0.17
735	0.19
736	0.22
737	0.23
738	0.25

A0A017SEB1

3D AlphaFold-predicted Structure Viewer