Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A017SCC2

Protein Details
Accession A0A017SCC2    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
37-62DLHIKLERIPKRRKPSRDKTPSFSSSHydrophilic
NLS Segment(s)
PositionSequence
44-53RIPKRRKPSR
Subcellular Location(s) nucl 17, mito 5.5, cyto_mito 5.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MNAHDGVRCTWETCSKLPTFINIAEFLAHAANIHHYDLHIKLERIPKRRKPSRDKTPSFSSSSMSLRLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.29
3 0.32
4 0.31
5 0.31
6 0.27
7 0.25
8 0.25
9 0.2
10 0.19
11 0.16
12 0.15
13 0.13
14 0.09
15 0.08
16 0.06
17 0.05
18 0.06
19 0.07
20 0.07
21 0.06
22 0.06
23 0.08
24 0.09
25 0.13
26 0.14
27 0.13
28 0.18
29 0.27
30 0.33
31 0.41
32 0.5
33 0.55
34 0.63
35 0.73
36 0.78
37 0.8
38 0.85
39 0.87
40 0.89
41 0.87
42 0.84
43 0.83
44 0.77
45 0.72
46 0.62
47 0.53
48 0.47
49 0.43