Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9BY10

Protein Details
Accession W9BY10    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
117-137YGSPRYIRWRVRTRRLRSWGIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 10, cyto_nucl 9.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MTSFQSAPSSSDNRHPTQPSNLNRPARTPLPSAPTTPRRPPITSSPSDATGSGRSPRTPLPSAPTSSRRPSRTPLPSAPTVSGEPSGAPLPSAPTIHGQPLGAPLQPTPAVPRRFPYGSPRYIRWRVRTRRLRSWGIVPDIKEPTAAEEALKHRCTELSGLRWSQNYIPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.48
3 0.46
4 0.52
5 0.59
6 0.57
7 0.6
8 0.66
9 0.66
10 0.63
11 0.62
12 0.59
13 0.54
14 0.5
15 0.45
16 0.41
17 0.4
18 0.41
19 0.41
20 0.43
21 0.48
22 0.51
23 0.53
24 0.56
25 0.55
26 0.55
27 0.56
28 0.57
29 0.57
30 0.53
31 0.51
32 0.46
33 0.43
34 0.42
35 0.37
36 0.29
37 0.23
38 0.23
39 0.21
40 0.2
41 0.18
42 0.2
43 0.22
44 0.27
45 0.27
46 0.26
47 0.28
48 0.3
49 0.33
50 0.35
51 0.38
52 0.37
53 0.42
54 0.47
55 0.45
56 0.45
57 0.46
58 0.5
59 0.52
60 0.53
61 0.5
62 0.48
63 0.47
64 0.45
65 0.42
66 0.35
67 0.28
68 0.23
69 0.18
70 0.13
71 0.1
72 0.1
73 0.09
74 0.07
75 0.06
76 0.05
77 0.07
78 0.08
79 0.08
80 0.08
81 0.09
82 0.1
83 0.11
84 0.12
85 0.1
86 0.09
87 0.12
88 0.12
89 0.11
90 0.1
91 0.09
92 0.11
93 0.12
94 0.12
95 0.14
96 0.21
97 0.23
98 0.24
99 0.26
100 0.3
101 0.31
102 0.33
103 0.37
104 0.37
105 0.42
106 0.45
107 0.48
108 0.51
109 0.58
110 0.63
111 0.62
112 0.65
113 0.67
114 0.74
115 0.8
116 0.79
117 0.81
118 0.82
119 0.79
120 0.72
121 0.71
122 0.66
123 0.63
124 0.58
125 0.49
126 0.48
127 0.44
128 0.4
129 0.33
130 0.26
131 0.23
132 0.22
133 0.21
134 0.15
135 0.18
136 0.22
137 0.29
138 0.3
139 0.26
140 0.25
141 0.25
142 0.27
143 0.28
144 0.31
145 0.3
146 0.36
147 0.39
148 0.41
149 0.42
150 0.43