FuNGI

W9CRT6

Protein Details

Accession

W9CRT6

Localization Confidence

Medium

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
430-454	ASVGTAKPSRKVKKLQKRGQGIEGL	Hydrophilic

NLS Segment(s)

Position	Sequence
437-447	PSRKVKKLQKR

Subcellular Location(s)

nucl 10.5, cyto_nucl 9, cyto 6.5, mito 5, plas 2, extr 2

Family & Domain DBs

InterPro	View protein in InterPro IPR023395 Mt_carrier_dom_sf
Gene Ontology	GO:0005743 C:mitochondrial inner membrane

Amino Acid Sequences

MSTSREGPNPLRPYYVPPSIGIPQEIPITTSGTHGVGLKNGSAASYASSARDIFSDIDYSDYLSDTSPSTIDSLQKFINETFTNYAGILCGQPFEIAKTVLQVKSQDVEDETTPAVVVEKIKRPPSDYNENYPSDDSDADETAYFTSAAPPAKSFSPSRRRYSSEGSEWEDKSTPKATSPKPKPAHQLILKRSDSIMEVISQEWSKEGAWGVWKGSNATFIYGFLLKTMESWLSSMISAGLNIPDPGLATLGVQVDVAGSPNPWTSLSVAIVAAATAGLILAPLDLVRTKLILTPTSDPKRSLTHNLNTLPSYICPPLLLVPTILHSIIKPTISHCTPLLLRTRLAIDPIITPTSYTTFTFLAQTLEIFIRLPIETVLRRGQAAVLTSLQYNEAQDLKTIVDIGPYNGVVGTMWSITREEGESSGPEPIASVGTAKPSRKVKKLQKRGQGIEGLWRGWRVGVWGLVGKYGSKAMSGVGSTEGEF

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.49
2	0.51
3	0.43
4	0.38
5	0.41
6	0.41
7	0.41
8	0.36
9	0.29
10	0.24
11	0.26
12	0.25
13	0.21
14	0.18
15	0.18
16	0.16
17	0.17
18	0.16
19	0.14
20	0.15
21	0.16
22	0.16
23	0.16
24	0.17
25	0.16
26	0.15
27	0.15
28	0.14
29	0.12
30	0.12
31	0.11
32	0.12
33	0.12
34	0.12
35	0.14
36	0.14
37	0.14
38	0.14
39	0.14
40	0.13
41	0.13
42	0.14
43	0.13
44	0.15
45	0.14
46	0.15
47	0.13
48	0.12
49	0.11
50	0.1
51	0.11
52	0.1
53	0.1
54	0.09
55	0.1
56	0.11
57	0.13
58	0.18
59	0.18
60	0.21
61	0.21
62	0.22
63	0.23
64	0.22
65	0.26
66	0.22
67	0.24
68	0.24
69	0.24
70	0.23
71	0.21
72	0.21
73	0.14
74	0.14
75	0.12
76	0.09
77	0.08
78	0.08
79	0.08
80	0.09
81	0.1
82	0.11
83	0.11
84	0.11
85	0.15
86	0.19
87	0.19
88	0.21
89	0.21
90	0.21
91	0.23
92	0.23
93	0.21
94	0.17
95	0.19
96	0.17
97	0.17
98	0.16
99	0.13
100	0.12
101	0.11
102	0.1
103	0.09
104	0.12
105	0.15
106	0.22
107	0.28
108	0.33
109	0.35
110	0.39
111	0.45
112	0.49
113	0.54
114	0.53
115	0.55
116	0.56
117	0.57
118	0.54
119	0.47
120	0.4
121	0.31
122	0.27
123	0.2
124	0.15
125	0.14
126	0.13
127	0.12
128	0.11
129	0.09
130	0.1
131	0.09
132	0.07
133	0.08
134	0.1
135	0.12
136	0.12
137	0.13
138	0.14
139	0.15
140	0.19
141	0.2
142	0.27
143	0.36
144	0.42
145	0.49
146	0.52
147	0.55
148	0.57
149	0.62
150	0.59
151	0.55
152	0.53
153	0.51
154	0.51
155	0.47
156	0.44
157	0.38
158	0.31
159	0.28
160	0.26
161	0.22
162	0.21
163	0.28
164	0.33
165	0.42
166	0.49
167	0.56
168	0.58
169	0.63
170	0.65
171	0.64
172	0.67
173	0.63
174	0.65
175	0.6
176	0.64
177	0.6
178	0.53
179	0.46
180	0.38
181	0.31
182	0.23
183	0.18
184	0.1
185	0.1
186	0.09
187	0.11
188	0.1
189	0.09
190	0.08
191	0.08
192	0.07
193	0.07
194	0.07
195	0.07
196	0.09
197	0.1
198	0.11
199	0.12
200	0.12
201	0.13
202	0.13
203	0.16
204	0.13
205	0.14
206	0.12
207	0.11
208	0.12
209	0.12
210	0.11
211	0.08
212	0.08
213	0.06
214	0.07
215	0.08
216	0.06
217	0.06
218	0.06
219	0.06
220	0.06
221	0.06
222	0.06
223	0.06
224	0.05
225	0.05
226	0.05
227	0.05
228	0.05
229	0.05
230	0.05
231	0.04
232	0.04
233	0.04
234	0.04
235	0.04
236	0.04
237	0.05
238	0.05
239	0.05
240	0.05
241	0.05
242	0.05
243	0.04
244	0.05
245	0.04
246	0.04
247	0.04
248	0.05
249	0.05
250	0.06
251	0.06
252	0.07
253	0.08
254	0.08
255	0.08
256	0.08
257	0.08
258	0.07
259	0.06
260	0.05
261	0.03
262	0.03
263	0.02
264	0.02
265	0.02
266	0.02
267	0.02
268	0.02
269	0.02
270	0.02
271	0.03
272	0.03
273	0.04
274	0.04
275	0.05
276	0.05
277	0.08
278	0.1
279	0.11
280	0.14
281	0.18
282	0.27
283	0.32
284	0.33
285	0.32
286	0.33
287	0.35
288	0.36
289	0.39
290	0.37
291	0.37
292	0.42
293	0.43
294	0.43
295	0.4
296	0.37
297	0.31
298	0.24
299	0.22
300	0.16
301	0.13
302	0.11
303	0.11
304	0.12
305	0.13
306	0.12
307	0.1
308	0.09
309	0.11
310	0.12
311	0.11
312	0.09
313	0.08
314	0.1
315	0.11
316	0.12
317	0.11
318	0.12
319	0.18
320	0.19
321	0.21
322	0.18
323	0.21
324	0.2
325	0.24
326	0.3
327	0.25
328	0.24
329	0.24
330	0.27
331	0.23
332	0.24
333	0.21
334	0.15
335	0.15
336	0.17
337	0.17
338	0.13
339	0.13
340	0.13
341	0.14
342	0.15
343	0.14
344	0.13
345	0.13
346	0.14
347	0.15
348	0.14
349	0.14
350	0.12
351	0.11
352	0.11
353	0.11
354	0.1
355	0.09
356	0.08
357	0.09
358	0.08
359	0.09
360	0.08
361	0.11
362	0.12
363	0.16
364	0.19
365	0.18
366	0.19
367	0.19
368	0.19
369	0.17
370	0.18
371	0.16
372	0.14
373	0.14
374	0.14
375	0.14
376	0.14
377	0.13
378	0.12
379	0.12
380	0.12
381	0.12
382	0.12
383	0.13
384	0.12
385	0.12
386	0.12
387	0.1
388	0.11
389	0.11
390	0.12
391	0.13
392	0.13
393	0.13
394	0.11
395	0.11
396	0.08
397	0.08
398	0.08
399	0.07
400	0.07
401	0.08
402	0.08
403	0.09
404	0.1
405	0.11
406	0.11
407	0.12
408	0.13
409	0.14
410	0.15
411	0.17
412	0.15
413	0.13
414	0.13
415	0.12
416	0.11
417	0.1
418	0.1
419	0.09
420	0.17
421	0.23
422	0.24
423	0.31
424	0.4
425	0.48
426	0.54
427	0.64
428	0.68
429	0.74
430	0.84
431	0.86
432	0.86
433	0.89
434	0.86
435	0.82
436	0.77
437	0.67
438	0.66
439	0.59
440	0.5
441	0.42
442	0.36
443	0.3
444	0.24
445	0.23
446	0.16
447	0.16
448	0.16
449	0.17
450	0.2
451	0.2
452	0.22
453	0.22
454	0.19
455	0.17
456	0.19
457	0.16
458	0.13
459	0.13
460	0.12
461	0.14
462	0.14
463	0.14
464	0.14

W9CRT6

3D AlphaFold-predicted Structure Viewer