Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3KDV8

Protein Details
Accession J3KDV8    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
101-131QRIPSGWTRRRHWRRRRRRHWWASGDRTRLRBasic
NLS Segment(s)
PositionSequence
108-121TRRRHWRRRRRRHW
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, pero 5, cyto 3.5, mito 3
Family & Domain DBs
KEGG cim:CIMG_04622  -  
Amino Acid Sequences MAPDCKCCPDYEDRAARECEDCQRGQGVHAGMCKRIHLLHHQRSFGEVSGRKAQDCQWRGHIVRDDLAWFRELLGGFEDLSIKVSRNPILKGGEPEPASEQRIPSGWTRRRHWRRRRRRHWWASGDRTRLRSSTRECQQHFEYESGPERARQRDIRISANGRRDAQWCRWRDLLALAKTIPGSRLRRQVAHEQKASIWHLPIPRARQGMSICLALETAREVKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.56
3 0.52
4 0.46
5 0.41
6 0.39
7 0.36
8 0.34
9 0.31
10 0.33
11 0.32
12 0.3
13 0.33
14 0.26
15 0.24
16 0.29
17 0.28
18 0.27
19 0.28
20 0.27
21 0.24
22 0.24
23 0.24
24 0.29
25 0.39
26 0.45
27 0.51
28 0.52
29 0.5
30 0.51
31 0.5
32 0.4
33 0.38
34 0.31
35 0.29
36 0.36
37 0.37
38 0.35
39 0.34
40 0.39
41 0.4
42 0.41
43 0.39
44 0.36
45 0.42
46 0.43
47 0.48
48 0.47
49 0.39
50 0.37
51 0.34
52 0.31
53 0.25
54 0.25
55 0.19
56 0.13
57 0.12
58 0.13
59 0.12
60 0.11
61 0.1
62 0.1
63 0.09
64 0.1
65 0.1
66 0.07
67 0.09
68 0.09
69 0.08
70 0.1
71 0.12
72 0.15
73 0.17
74 0.18
75 0.2
76 0.22
77 0.23
78 0.25
79 0.24
80 0.26
81 0.23
82 0.23
83 0.23
84 0.22
85 0.23
86 0.2
87 0.19
88 0.15
89 0.15
90 0.16
91 0.17
92 0.25
93 0.29
94 0.35
95 0.39
96 0.5
97 0.6
98 0.69
99 0.76
100 0.77
101 0.82
102 0.87
103 0.94
104 0.93
105 0.94
106 0.94
107 0.93
108 0.92
109 0.89
110 0.88
111 0.84
112 0.8
113 0.72
114 0.65
115 0.56
116 0.47
117 0.41
118 0.37
119 0.36
120 0.39
121 0.43
122 0.48
123 0.48
124 0.52
125 0.51
126 0.5
127 0.46
128 0.38
129 0.31
130 0.26
131 0.27
132 0.25
133 0.23
134 0.22
135 0.24
136 0.26
137 0.31
138 0.32
139 0.35
140 0.4
141 0.43
142 0.44
143 0.46
144 0.49
145 0.49
146 0.53
147 0.51
148 0.45
149 0.44
150 0.43
151 0.42
152 0.45
153 0.47
154 0.43
155 0.44
156 0.44
157 0.42
158 0.4
159 0.42
160 0.41
161 0.35
162 0.34
163 0.29
164 0.29
165 0.29
166 0.28
167 0.23
168 0.22
169 0.26
170 0.3
171 0.39
172 0.42
173 0.45
174 0.5
175 0.59
176 0.62
177 0.64
178 0.61
179 0.54
180 0.51
181 0.53
182 0.52
183 0.43
184 0.34
185 0.29
186 0.29
187 0.34
188 0.38
189 0.38
190 0.41
191 0.41
192 0.41
193 0.42
194 0.41
195 0.41
196 0.37
197 0.33
198 0.27
199 0.24
200 0.23
201 0.17
202 0.16
203 0.14