Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9CKQ1

Protein Details
Accession W9CKQ1    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
61-86ADDAHCKKVWRRRRKKYELYVLRYAVHydrophilic
NLS Segment(s)
PositionSequence
71-75RRRRK
Subcellular Location(s) mito 15, nucl 6, cyto 3, extr 1, pero 1, E.R. 1
Family & Domain DBs
Amino Acid Sequences MKLSQSLSILTLLVASTAAVGLPHDNTYKKCLTEGTFCEGFAGSVGTCCKGLVCENEPFVADDAHCKKVWRRRRKKYELYVLRYAVENENHSPLVLMTLSERH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.04
4 0.04
5 0.04
6 0.03
7 0.04
8 0.05
9 0.06
10 0.08
11 0.11
12 0.13
13 0.15
14 0.2
15 0.22
16 0.22
17 0.21
18 0.23
19 0.23
20 0.28
21 0.29
22 0.3
23 0.28
24 0.27
25 0.27
26 0.24
27 0.2
28 0.14
29 0.12
30 0.05
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.08
39 0.1
40 0.13
41 0.14
42 0.15
43 0.15
44 0.16
45 0.16
46 0.14
47 0.12
48 0.09
49 0.13
50 0.16
51 0.19
52 0.19
53 0.2
54 0.25
55 0.35
56 0.45
57 0.5
58 0.58
59 0.67
60 0.78
61 0.87
62 0.91
63 0.92
64 0.93
65 0.92
66 0.88
67 0.84
68 0.74
69 0.64
70 0.55
71 0.47
72 0.4
73 0.32
74 0.29
75 0.24
76 0.26
77 0.25
78 0.24
79 0.22
80 0.18
81 0.17
82 0.13
83 0.11