Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9CH76

Protein Details
Accession W9CH76    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
25-44HSIHPSPKSHSKPKTNPSLPHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 16, mito 10.5, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008972  Cupredoxin  
IPR003245  Phytocyanin_dom  
Gene Ontology GO:0009055  F:electron transfer activity  
Pfam View protein in Pfam  
PF02298  Cu_bind_like  
CDD cd00920  Cupredoxin  
Amino Acid Sequences MHFTPTLLLSALSISSVLGKSSLPHSIHPSPKSHSKPKTNPSLPLPPAAANTTKAPTTSTTTHVVRVGSSTNNSVKYFPDNITAAVGDVIQFQFAAGNHTVTQSTFDAPCVPISQSSNTTGVYSGFMDVGAGGKATGMVPVFSMMVKAKTPMWFYCSQAKHCQKGMVLVVNEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.08
3 0.08
4 0.08
5 0.08
6 0.08
7 0.09
8 0.12
9 0.19
10 0.18
11 0.21
12 0.28
13 0.36
14 0.43
15 0.45
16 0.47
17 0.45
18 0.54
19 0.59
20 0.61
21 0.63
22 0.66
23 0.72
24 0.76
25 0.82
26 0.76
27 0.74
28 0.71
29 0.71
30 0.62
31 0.55
32 0.48
33 0.38
34 0.36
35 0.32
36 0.27
37 0.19
38 0.2
39 0.18
40 0.17
41 0.16
42 0.16
43 0.16
44 0.19
45 0.19
46 0.2
47 0.24
48 0.25
49 0.26
50 0.26
51 0.24
52 0.19
53 0.18
54 0.17
55 0.13
56 0.13
57 0.15
58 0.16
59 0.18
60 0.19
61 0.18
62 0.18
63 0.2
64 0.21
65 0.18
66 0.19
67 0.17
68 0.16
69 0.16
70 0.15
71 0.11
72 0.09
73 0.08
74 0.05
75 0.05
76 0.05
77 0.04
78 0.04
79 0.04
80 0.05
81 0.05
82 0.08
83 0.07
84 0.09
85 0.09
86 0.1
87 0.1
88 0.09
89 0.12
90 0.09
91 0.11
92 0.1
93 0.1
94 0.11
95 0.11
96 0.12
97 0.11
98 0.1
99 0.11
100 0.13
101 0.15
102 0.16
103 0.18
104 0.18
105 0.17
106 0.17
107 0.16
108 0.14
109 0.13
110 0.11
111 0.09
112 0.08
113 0.07
114 0.07
115 0.06
116 0.06
117 0.05
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.06
124 0.05
125 0.05
126 0.06
127 0.07
128 0.07
129 0.07
130 0.09
131 0.09
132 0.11
133 0.11
134 0.12
135 0.15
136 0.19
137 0.23
138 0.23
139 0.28
140 0.29
141 0.32
142 0.4
143 0.42
144 0.43
145 0.5
146 0.57
147 0.57
148 0.58
149 0.59
150 0.5
151 0.52
152 0.52
153 0.49