Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9CC01

Protein Details
Accession W9CC01    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
57-83VKQKPVEKKPTEKKPDAKKPVERNLVKBasic
NLS Segment(s)
PositionSequence
63-75EKKPTEKKPDAKK
Subcellular Location(s) nucl 12.5, mito_nucl 10.666, cyto_nucl 10.333, mito 7.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MNQLCLECPEARKIIFRVIVRDYYFLYEYLSPTMLTQLFDKSKGTVTNNGEFETCLVKQKPVEKKPTEKKPDAKKPVERNLVKEQPIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.35
3 0.34
4 0.34
5 0.35
6 0.4
7 0.36
8 0.36
9 0.3
10 0.27
11 0.26
12 0.21
13 0.19
14 0.15
15 0.15
16 0.14
17 0.14
18 0.11
19 0.1
20 0.12
21 0.11
22 0.1
23 0.1
24 0.13
25 0.13
26 0.14
27 0.15
28 0.13
29 0.14
30 0.16
31 0.18
32 0.2
33 0.23
34 0.28
35 0.28
36 0.28
37 0.26
38 0.23
39 0.22
40 0.18
41 0.15
42 0.15
43 0.15
44 0.16
45 0.19
46 0.27
47 0.37
48 0.41
49 0.5
50 0.51
51 0.62
52 0.7
53 0.78
54 0.79
55 0.78
56 0.8
57 0.81
58 0.86
59 0.86
60 0.85
61 0.84
62 0.84
63 0.86
64 0.87
65 0.8
66 0.76
67 0.76
68 0.75