Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9CJ04

Protein Details
Accession W9CJ04   
Localization Confidence Low
Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-27QDKSTPSRHFARPRRASPKPSSNMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 7, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009056  Cyt_c-like_dom  
IPR036909  Cyt_c-like_dom_sf  
IPR002327  Cyt_c_1A/1B  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
GO:0070469  C:respirasome  
GO:0009055  F:electron transfer activity  
GO:0020037  F:heme binding  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF00034  Cytochrom_C  
PROSITE View protein in PROSITE  
PS51007  CYTC  
Amino Acid Sequences MSPQDKSTPSRHFARPRRASPKPSSNMLEGCSIYLSLTWASNFSQLRSPLGSTGTSKFATCMTSKCLQVSSTGDSKKGANLFKTRCAQCHTLAEGEPNKIGPNLHALFGRQTGSVEGYSYTDANKQKAITWGEDTLVEYLENPKKYIPGTKMAFGGLKKEKDRNDLVQYLKEATA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.76
3 0.79
4 0.83
5 0.84
6 0.83
7 0.82
8 0.83
9 0.77
10 0.74
11 0.68
12 0.62
13 0.56
14 0.49
15 0.43
16 0.33
17 0.28
18 0.22
19 0.18
20 0.13
21 0.11
22 0.11
23 0.08
24 0.08
25 0.08
26 0.09
27 0.09
28 0.15
29 0.15
30 0.16
31 0.2
32 0.2
33 0.22
34 0.23
35 0.23
36 0.18
37 0.19
38 0.19
39 0.16
40 0.18
41 0.19
42 0.18
43 0.17
44 0.16
45 0.16
46 0.16
47 0.15
48 0.15
49 0.16
50 0.19
51 0.2
52 0.2
53 0.2
54 0.18
55 0.2
56 0.21
57 0.19
58 0.21
59 0.21
60 0.21
61 0.21
62 0.21
63 0.21
64 0.23
65 0.21
66 0.19
67 0.26
68 0.27
69 0.32
70 0.39
71 0.37
72 0.35
73 0.38
74 0.36
75 0.31
76 0.33
77 0.28
78 0.23
79 0.22
80 0.24
81 0.21
82 0.19
83 0.17
84 0.14
85 0.13
86 0.12
87 0.12
88 0.08
89 0.13
90 0.13
91 0.14
92 0.14
93 0.15
94 0.15
95 0.17
96 0.17
97 0.1
98 0.1
99 0.09
100 0.11
101 0.1
102 0.09
103 0.09
104 0.09
105 0.09
106 0.09
107 0.09
108 0.14
109 0.16
110 0.17
111 0.19
112 0.18
113 0.2
114 0.26
115 0.28
116 0.25
117 0.26
118 0.25
119 0.24
120 0.24
121 0.23
122 0.17
123 0.14
124 0.11
125 0.09
126 0.15
127 0.2
128 0.21
129 0.2
130 0.21
131 0.22
132 0.24
133 0.32
134 0.28
135 0.32
136 0.34
137 0.36
138 0.36
139 0.36
140 0.38
141 0.31
142 0.35
143 0.34
144 0.37
145 0.4
146 0.46
147 0.49
148 0.52
149 0.58
150 0.57
151 0.58
152 0.57
153 0.56
154 0.54
155 0.51