Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E1RWR0

Protein Details
Accession A0A0E1RWR0    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
157-177VGSEQPVRRRRRQHRAMAAAEHydrophilic
NLS Segment(s)
PositionSequence
57-69ENERARAKKKSKP
Subcellular Location(s) nucl 14.5, mito 10, cyto_nucl 8.5
Family & Domain DBs
KEGG cim:CIMG_08085  -  
Amino Acid Sequences MAPIRRYLRISKCSVLECRIYLENPSDSRWLLDPRDPVLPRVFKSIRPLVLPKLREENERARAKKKSKPVKDVLVEDDFQVSIFLRETGTRHSITTRRKTFGDGGRISSNSNKLTGNNDDPIHIPDDSEQPVHPLLVEEEDSPVNLHDIPEAQPDDVGSEQPVRRRRRQHRAMAAAEDEDGASMRPSKRARAETLTEAIAHDEKKLAMTTTYEGFDIWGWILCLLVSRRDRTKAAPASGESSNQALMEEWICTQAPQEYDEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.54
3 0.48
4 0.42
5 0.4
6 0.38
7 0.34
8 0.31
9 0.3
10 0.31
11 0.29
12 0.31
13 0.29
14 0.26
15 0.28
16 0.28
17 0.29
18 0.27
19 0.31
20 0.31
21 0.31
22 0.39
23 0.38
24 0.37
25 0.4
26 0.42
27 0.38
28 0.44
29 0.43
30 0.38
31 0.45
32 0.48
33 0.43
34 0.43
35 0.45
36 0.44
37 0.5
38 0.48
39 0.44
40 0.46
41 0.45
42 0.45
43 0.47
44 0.47
45 0.5
46 0.57
47 0.57
48 0.54
49 0.61
50 0.64
51 0.66
52 0.67
53 0.69
54 0.69
55 0.75
56 0.76
57 0.76
58 0.75
59 0.71
60 0.65
61 0.58
62 0.49
63 0.39
64 0.33
65 0.23
66 0.18
67 0.15
68 0.09
69 0.06
70 0.07
71 0.06
72 0.06
73 0.08
74 0.09
75 0.13
76 0.16
77 0.16
78 0.16
79 0.2
80 0.27
81 0.35
82 0.44
83 0.44
84 0.44
85 0.44
86 0.47
87 0.49
88 0.49
89 0.49
90 0.4
91 0.39
92 0.38
93 0.38
94 0.35
95 0.31
96 0.29
97 0.21
98 0.21
99 0.18
100 0.16
101 0.2
102 0.23
103 0.22
104 0.22
105 0.21
106 0.21
107 0.21
108 0.21
109 0.19
110 0.15
111 0.12
112 0.1
113 0.12
114 0.12
115 0.12
116 0.11
117 0.1
118 0.11
119 0.1
120 0.09
121 0.07
122 0.06
123 0.06
124 0.07
125 0.06
126 0.07
127 0.07
128 0.07
129 0.07
130 0.07
131 0.06
132 0.06
133 0.06
134 0.05
135 0.06
136 0.07
137 0.1
138 0.11
139 0.1
140 0.1
141 0.09
142 0.11
143 0.1
144 0.09
145 0.07
146 0.11
147 0.12
148 0.19
149 0.27
150 0.32
151 0.39
152 0.5
153 0.59
154 0.66
155 0.74
156 0.79
157 0.8
158 0.82
159 0.77
160 0.69
161 0.6
162 0.5
163 0.4
164 0.3
165 0.2
166 0.11
167 0.09
168 0.06
169 0.05
170 0.09
171 0.09
172 0.16
173 0.18
174 0.24
175 0.31
176 0.35
177 0.4
178 0.42
179 0.46
180 0.44
181 0.45
182 0.4
183 0.33
184 0.28
185 0.25
186 0.21
187 0.17
188 0.13
189 0.12
190 0.11
191 0.12
192 0.13
193 0.11
194 0.1
195 0.12
196 0.14
197 0.15
198 0.16
199 0.14
200 0.13
201 0.13
202 0.13
203 0.11
204 0.1
205 0.08
206 0.07
207 0.07
208 0.07
209 0.06
210 0.1
211 0.11
212 0.18
213 0.21
214 0.26
215 0.31
216 0.36
217 0.39
218 0.39
219 0.48
220 0.48
221 0.49
222 0.48
223 0.45
224 0.45
225 0.44
226 0.42
227 0.33
228 0.27
229 0.23
230 0.18
231 0.16
232 0.13
233 0.13
234 0.12
235 0.11
236 0.1
237 0.12
238 0.12
239 0.12
240 0.12
241 0.15
242 0.15