Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D8JWT1

Protein Details
Accession A0A0D8JWT1    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
95-116KRNTYNPSRRVQKRRHGFLARLHydrophilic
119-138RGGRNILSRRRSKGRKYLTWHydrophilic
NLS Segment(s)
PositionSequence
103-134RRVQKRRHGFLARLRCRGGRNILSRRRSKGRK
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cim:CIMG_12372  -  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MMCLRGSRTVSFNLSPTRRIVDRISRTALSQTVPRSPFQPARSLSFATFSTFRSLFPPTRTTTQSPLSTPFSSLLLSTPGSASRQFSTTAALGAKRNTYNPSRRVQKRRHGFLARLRCRGGRNILSRRRSKGRKYLTW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.37
3 0.36
4 0.37
5 0.33
6 0.35
7 0.37
8 0.38
9 0.43
10 0.47
11 0.49
12 0.44
13 0.44
14 0.43
15 0.39
16 0.3
17 0.27
18 0.24
19 0.27
20 0.28
21 0.27
22 0.27
23 0.31
24 0.36
25 0.33
26 0.38
27 0.33
28 0.36
29 0.39
30 0.39
31 0.33
32 0.29
33 0.27
34 0.22
35 0.21
36 0.17
37 0.18
38 0.17
39 0.17
40 0.17
41 0.2
42 0.2
43 0.22
44 0.25
45 0.23
46 0.27
47 0.3
48 0.3
49 0.31
50 0.33
51 0.32
52 0.29
53 0.3
54 0.31
55 0.27
56 0.25
57 0.22
58 0.17
59 0.15
60 0.14
61 0.11
62 0.08
63 0.08
64 0.08
65 0.07
66 0.08
67 0.09
68 0.09
69 0.11
70 0.1
71 0.11
72 0.12
73 0.12
74 0.14
75 0.13
76 0.13
77 0.13
78 0.14
79 0.14
80 0.14
81 0.18
82 0.16
83 0.18
84 0.21
85 0.28
86 0.34
87 0.38
88 0.45
89 0.52
90 0.61
91 0.69
92 0.74
93 0.77
94 0.8
95 0.83
96 0.84
97 0.8
98 0.77
99 0.77
100 0.79
101 0.76
102 0.71
103 0.65
104 0.59
105 0.55
106 0.55
107 0.54
108 0.52
109 0.54
110 0.59
111 0.66
112 0.72
113 0.76
114 0.77
115 0.79
116 0.8
117 0.79
118 0.79