Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9CEB6

Protein Details
Accession W9CEB6    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPSTSPQKKRHLRSRVRALALAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13mito 13mito_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
Amino Acid Sequences MPSTSPQKKRHLRSRVRALALADANALVNDNIRNSKKKEEEEEEAEEQSNIDDQHRWDDWVPQDRVMKFNEDNKELAAQLFQEMKKLYQKPKSATTTTSAGGKKLVGGNRTNESDFGSGRGSEERHASVAAQGGGGRGGPRRNRDYDLEQVSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.89
3 0.84
4 0.76
5 0.67
6 0.63
7 0.54
8 0.43
9 0.32
10 0.23
11 0.18
12 0.15
13 0.14
14 0.07
15 0.07
16 0.07
17 0.09
18 0.15
19 0.19
20 0.25
21 0.27
22 0.36
23 0.42
24 0.46
25 0.52
26 0.52
27 0.55
28 0.54
29 0.57
30 0.5
31 0.44
32 0.39
33 0.31
34 0.24
35 0.18
36 0.15
37 0.09
38 0.08
39 0.09
40 0.09
41 0.14
42 0.15
43 0.16
44 0.15
45 0.2
46 0.24
47 0.3
48 0.31
49 0.3
50 0.34
51 0.33
52 0.34
53 0.31
54 0.3
55 0.23
56 0.29
57 0.29
58 0.26
59 0.25
60 0.24
61 0.23
62 0.19
63 0.17
64 0.11
65 0.07
66 0.07
67 0.1
68 0.09
69 0.11
70 0.11
71 0.13
72 0.19
73 0.24
74 0.29
75 0.34
76 0.4
77 0.42
78 0.49
79 0.53
80 0.48
81 0.45
82 0.42
83 0.37
84 0.33
85 0.35
86 0.27
87 0.22
88 0.21
89 0.19
90 0.18
91 0.19
92 0.22
93 0.19
94 0.22
95 0.25
96 0.28
97 0.31
98 0.3
99 0.26
100 0.25
101 0.23
102 0.21
103 0.19
104 0.16
105 0.13
106 0.14
107 0.16
108 0.15
109 0.15
110 0.18
111 0.17
112 0.17
113 0.17
114 0.16
115 0.15
116 0.17
117 0.15
118 0.13
119 0.11
120 0.11
121 0.11
122 0.11
123 0.11
124 0.12
125 0.19
126 0.25
127 0.33
128 0.39
129 0.44
130 0.48
131 0.54
132 0.56
133 0.58