Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9CPI8

Protein Details
Accession W9CPI8    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-35KTNSSSEKKSKEEKPKKKPKDSEKSKPEGNBasic
NLS Segment(s)
PositionSequence
13-32KKSKEEKPKKKPKDSEKSKP
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MFCFTKTNSSSEKKSKEEKPKKKPKDSEKSKPEGNSDGSKKPTDNSHHDVPCGNEENDAGDHWRGYPDHDAECYEEDC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.67
3 0.71
4 0.76
5 0.79
6 0.81
7 0.86
8 0.9
9 0.92
10 0.92
11 0.92
12 0.92
13 0.91
14 0.91
15 0.88
16 0.84
17 0.77
18 0.7
19 0.62
20 0.54
21 0.48
22 0.44
23 0.39
24 0.37
25 0.35
26 0.34
27 0.31
28 0.28
29 0.31
30 0.3
31 0.33
32 0.35
33 0.4
34 0.4
35 0.41
36 0.41
37 0.36
38 0.35
39 0.32
40 0.26
41 0.19
42 0.18
43 0.19
44 0.19
45 0.18
46 0.15
47 0.12
48 0.12
49 0.11
50 0.14
51 0.12
52 0.15
53 0.21
54 0.22
55 0.24
56 0.25
57 0.26
58 0.26