Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3K1P2

Protein Details
Accession J3K1P2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
14-34LLRSRCSPRPPQSTTNRQPVSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR005746  Thioredoxin  
IPR036249  Thioredoxin-like_sf  
IPR017937  Thioredoxin_CS  
IPR013766  Thioredoxin_domain  
Gene Ontology GO:0015035  F:protein-disulfide reductase activity  
KEGG cim:CIMG_09126  -  
Pfam View protein in Pfam  
PF00085  Thioredoxin  
PROSITE View protein in PROSITE  
PS00194  THIOREDOXIN_1  
PS51352  THIOREDOXIN_2  
CDD cd02947  TRX_family  
Amino Acid Sequences MAAITSSRAPLLSLLRSRCSPRPPQSTTNRQPVSPLRHPAHPAHPAHPVATAALFRPSTCTVASSLLRVLPSASASLSSSARRTFSTTLPPRFRGTAANMVVTALKDNAAFQAAINPAAVASEGKKLVVVDCFATWCGPCQAIAPKVNEFSEKYPDVAFYKIDVDDAPDVAQELGVRAMPTFVFFKDGQKVDEVLGAVPPALEAAIQKNRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.34
3 0.38
4 0.43
5 0.47
6 0.5
7 0.53
8 0.57
9 0.63
10 0.66
11 0.71
12 0.75
13 0.8
14 0.8
15 0.81
16 0.73
17 0.64
18 0.63
19 0.62
20 0.61
21 0.57
22 0.58
23 0.51
24 0.54
25 0.58
26 0.57
27 0.56
28 0.55
29 0.5
30 0.44
31 0.47
32 0.43
33 0.4
34 0.36
35 0.28
36 0.21
37 0.19
38 0.16
39 0.1
40 0.13
41 0.13
42 0.11
43 0.16
44 0.16
45 0.17
46 0.17
47 0.17
48 0.14
49 0.19
50 0.19
51 0.16
52 0.15
53 0.15
54 0.15
55 0.14
56 0.13
57 0.09
58 0.09
59 0.08
60 0.07
61 0.07
62 0.07
63 0.09
64 0.1
65 0.11
66 0.12
67 0.13
68 0.14
69 0.14
70 0.17
71 0.18
72 0.18
73 0.28
74 0.34
75 0.41
76 0.44
77 0.45
78 0.44
79 0.42
80 0.41
81 0.34
82 0.3
83 0.29
84 0.26
85 0.24
86 0.22
87 0.21
88 0.2
89 0.17
90 0.14
91 0.06
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.05
99 0.09
100 0.09
101 0.09
102 0.09
103 0.08
104 0.07
105 0.07
106 0.08
107 0.04
108 0.05
109 0.07
110 0.07
111 0.07
112 0.08
113 0.08
114 0.09
115 0.09
116 0.09
117 0.08
118 0.08
119 0.09
120 0.09
121 0.09
122 0.08
123 0.09
124 0.09
125 0.08
126 0.08
127 0.1
128 0.15
129 0.19
130 0.23
131 0.24
132 0.25
133 0.27
134 0.28
135 0.28
136 0.25
137 0.23
138 0.25
139 0.24
140 0.23
141 0.21
142 0.23
143 0.22
144 0.21
145 0.18
146 0.13
147 0.15
148 0.14
149 0.14
150 0.12
151 0.13
152 0.12
153 0.12
154 0.11
155 0.09
156 0.1
157 0.09
158 0.09
159 0.06
160 0.06
161 0.06
162 0.07
163 0.07
164 0.07
165 0.08
166 0.07
167 0.1
168 0.11
169 0.1
170 0.14
171 0.14
172 0.19
173 0.26
174 0.28
175 0.27
176 0.28
177 0.28
178 0.25
179 0.27
180 0.23
181 0.15
182 0.15
183 0.13
184 0.11
185 0.09
186 0.08
187 0.06
188 0.05
189 0.05
190 0.05
191 0.13