Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9CF70

Protein Details
Accession W9CF70    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
96-118GSMSKNRISKRKVNSRKSSMTFVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKGSRSSSIKANNVALKKKVFGPVETARAERMHAKLLELIAQPKPSAKSEDVEMDVKDGEDVEEASAKDTSSKAVSPPQEKPSEEMEVDAISKVGSMSKNRISKRKVNSRKSSMTFVTYKKGKKVGGGGSQKIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.55
3 0.52
4 0.46
5 0.43
6 0.42
7 0.44
8 0.4
9 0.34
10 0.37
11 0.37
12 0.41
13 0.41
14 0.38
15 0.32
16 0.3
17 0.3
18 0.27
19 0.23
20 0.23
21 0.21
22 0.21
23 0.21
24 0.21
25 0.24
26 0.2
27 0.22
28 0.18
29 0.19
30 0.18
31 0.18
32 0.2
33 0.17
34 0.21
35 0.19
36 0.18
37 0.19
38 0.22
39 0.22
40 0.22
41 0.2
42 0.16
43 0.15
44 0.13
45 0.11
46 0.08
47 0.06
48 0.04
49 0.05
50 0.04
51 0.06
52 0.06
53 0.07
54 0.07
55 0.07
56 0.07
57 0.07
58 0.08
59 0.08
60 0.08
61 0.09
62 0.14
63 0.18
64 0.22
65 0.27
66 0.31
67 0.34
68 0.34
69 0.36
70 0.34
71 0.33
72 0.29
73 0.24
74 0.2
75 0.16
76 0.16
77 0.13
78 0.09
79 0.05
80 0.05
81 0.05
82 0.07
83 0.09
84 0.12
85 0.17
86 0.25
87 0.32
88 0.37
89 0.46
90 0.49
91 0.55
92 0.63
93 0.69
94 0.72
95 0.76
96 0.81
97 0.82
98 0.85
99 0.8
100 0.77
101 0.68
102 0.63
103 0.58
104 0.51
105 0.51
106 0.49
107 0.49
108 0.49
109 0.52
110 0.48
111 0.48
112 0.52
113 0.52
114 0.55
115 0.59