Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9C3L8

Protein Details
Accession W9C3L8   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
61-90DECVKKAKEAKEEKKEKKKSEKSKSGGGCABasic
NLS Segment(s)
PositionSequence
65-84KKAKEAKEEKKEKKKSEKSK
Subcellular Location(s) nucl 15.5, mito_nucl 11.5, mito 6.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MSPAEWRCDNSGNVKGFVKRKGDSNPLNWGYHVDKKILDHPKIGMIKTNVAKPEKKENKCDECVKKAKEAKEEKKEKKKSEKSKSGGGCAVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.4
3 0.41
4 0.44
5 0.44
6 0.37
7 0.4
8 0.44
9 0.5
10 0.49
11 0.49
12 0.52
13 0.5
14 0.49
15 0.44
16 0.41
17 0.35
18 0.37
19 0.34
20 0.26
21 0.23
22 0.24
23 0.32
24 0.36
25 0.33
26 0.28
27 0.27
28 0.32
29 0.33
30 0.32
31 0.27
32 0.2
33 0.24
34 0.25
35 0.27
36 0.24
37 0.25
38 0.28
39 0.27
40 0.37
41 0.43
42 0.45
43 0.51
44 0.56
45 0.6
46 0.64
47 0.7
48 0.65
49 0.64
50 0.69
51 0.63
52 0.63
53 0.62
54 0.61
55 0.62
56 0.66
57 0.67
58 0.69
59 0.78
60 0.79
61 0.84
62 0.88
63 0.88
64 0.89
65 0.89
66 0.9
67 0.9
68 0.9
69 0.85
70 0.85
71 0.81
72 0.76